x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300029312
3300029312: Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 006_6_10_stool_2
Overview
Basic Information
IMG/M Taxon OID 3300029312 Open in IMG/M GOLD Reference Gs0133095 | Gp0281880 | Ga0242764 Sample Name Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 006_6_10_stool_2 Sequencing Status Permanent Draft Sequencing Center Institute for Genome Sciences, University of Maryland School of Medicine Published? N Use Policy Open
Dataset Contents
Total Genome Size 30916944 Sequencing Scaffolds 1 Novel Protein Genes 1 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → Collinsella aerofaciens 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal distal gut
Location Information
Location USA: Baltimore Coordinates Lat. (o ) 39.28846264 Long. (o ) -76.62594594 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F099269 Metagenome 103 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0242764_100948 All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → Collinsella aerofaciens 4580 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0242764_100948 Ga0242764_1009481 F099269 VHGVLVSVQVGELLLLDDLGDRAGGASVLASATGDAGILVSDGSDVLELQNASGAGVDANATSDALVGINYGMSHGSFLSVDRRYRRCASV
