NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029371

3300029371: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 081_4_28_stool_1



Overview

Basic Information
IMG/M Taxon OID3300029371 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133117 | Gp0283119 | Ga0243958
Sample NameHuman feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 081_4_28_stool_1
Sequencing StatusPermanent Draft
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size149087922
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia wexlerae1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: Baltimore
CoordinatesLat. (o)39.28846264Long. (o)-76.62594594Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026592Metagenome / Metatranscriptome197Y
F059106Metagenome134N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0243958_100430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia wexlerae53891Open in IMG/M
Ga0243958_119843Not Available964Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0243958_100430Ga0243958_10043047F059106VWKIRVILLQTFVWIVDLKVREHLTEYLKKDIKYHRVTTGVHV
Ga0243958_119843Ga0243958_1198432F026592FSNLLAANSISCCLRTASPQGIDAQASQGSVAPLTEQSDETFSVGQFSSADRE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.