NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029411

3300029411: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_13_stool_2



Overview

Basic Information
IMG/M Taxon OID3300029411 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0133117 | Gp0283022 | Ga0243861
Sample NameHuman feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_13_stool_2
Sequencing StatusPermanent Draft
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size171049157
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena5
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae1
All Organisms → Viruses → Predicted Viral1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: Baltimore
CoordinatesLat. (o)39.28846264Long. (o)-76.62594594Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032286Metagenome / Metatranscriptome180Y
F056309Metagenome137N
F070093Metagenome123N
F071325Metagenome122N
F097493Metagenome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0243861_100116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena126144Open in IMG/M
Ga0243861_100733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae35291Open in IMG/M
Ga0243861_101473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena15649Open in IMG/M
Ga0243861_104383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena4823Open in IMG/M
Ga0243861_107843All Organisms → Viruses → Predicted Viral2743Open in IMG/M
Ga0243861_110531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena2078Open in IMG/M
Ga0243861_111890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena1855Open in IMG/M
Ga0243861_132722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes718Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0243861_100116Ga0243861_100116104F070093FCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN
Ga0243861_100733Ga0243861_1007331F071325SIFKVLLALLSDSSIIISKVVLFVKHFFDIFLSLPNAFLKAFHPHAVRFPAAFLLVHRFYLAFEELLSCATAYL
Ga0243861_101473Ga0243861_10147315F056309CLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD
Ga0243861_104383Ga0243861_1043831F070093SLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPK
Ga0243861_107843Ga0243861_1078432F097493MYKFYSKNGTAQFYERGVEIDGTVYGIRTDSDILRIKRSVVNSKFAESEEDFDMNVEIAKIQHMDITLEQPTSEQLSQIQAKTYNSMTELKQHVQSIMNGELTQDEINAMLLLRIAEMEVAITNEQTTN
Ga0243861_110531Ga0243861_1105315F070093EFCPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPN
Ga0243861_111890Ga0243861_1118901F070093LLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLMN
Ga0243861_132722Ga0243861_1327221F032286MVKWICQIVTPVRHRALVFNTRLFAGNAADDTLVTGGTFRFCRLVCLCVKRRNIILNGKRRSLLNSTLFRADNRTEQKTISPFSLALIFTFDFAALSERRSCPEDRSRRFVPVGTLTLSRSWRLLRRGTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENAPKIADFHAYGQDRKRAEI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.