Basic Information | |
---|---|
IMG/M Taxon OID | 3300029428 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133095 | Gp0281904 | Ga0242788 |
Sample Name | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 008_6_3_stool_1 |
Sequencing Status | Permanent Draft |
Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 210206419 |
Sequencing Scaffolds | 6 |
Novel Protein Genes | 6 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 2 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Baltimore | |||||||
Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056309 | Metagenome | 137 | N |
F070093 | Metagenome | 123 | N |
F078822 | Metagenome | 116 | N |
F088920 | Metagenome | 109 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0242788_101243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 26428 | Open in IMG/M |
Ga0242788_101257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 26026 | Open in IMG/M |
Ga0242788_101337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 24209 | Open in IMG/M |
Ga0242788_101475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 21415 | Open in IMG/M |
Ga0242788_102562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 10702 | Open in IMG/M |
Ga0242788_102722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 9956 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0242788_101243 | Ga0242788_10124323 | F078822 | FPNAFLKAFHPHAVRFPAAFLLVHRFYLAFEELLSCATAYL |
Ga0242788_101257 | Ga0242788_10125710 | F056309 | VXXXXPSLSVVPLLLGDSDSLSVSYGYGMEPEQEALSIVSFKD |
Ga0242788_101337 | Ga0242788_1013371 | F070093 | RVSNFESLLLAEFYPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN |
Ga0242788_101475 | Ga0242788_10147518 | F078822 | SFPNAFLKAFHPHAVRSPAAFLLVHRFYLAFEELLSCATAYL |
Ga0242788_102562 | Ga0242788_10256210 | F088920 | LFVKWNPKNHHFIFLFLAFFSFVSANLHHYPAFWAGLILHLILHFSQKVAIFAPKRAILLIFVPTLFFACLAAFSLHTSPKISGQTSLHQPWLSPYCLFKD |
Ga0242788_102722 | Ga0242788_1027221 | F070093 | SLLLAEFCPFRIDPPMEPEQEHLSKLYSVSGIHSLPELNPD |
⦗Top⦘ |