 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029456 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133130 | Gp0283296 | Ga0244119 |
| Sample Name | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001874-21 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 91060580 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Shanghai | |||||||
| Coordinates | Lat. (o) | 31.2123446 | Long. (o) | 121.4684853 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055715 | Metagenome | 138 | N |
| F068811 | Metagenome | 124 | N |
| F073656 | Metagenome | 120 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0244119_104196 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | 3317 | Open in IMG/M |
| Ga0244119_106240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2181 | Open in IMG/M |
| Ga0244119_111359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1122 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0244119_104196 | Ga0244119_1041961 | F073656 | MEQEQDQEQTQAALYVAVDDGNKIVAMERSRRGDEGFRALLDEFTDYAANRGEIPSVLFFDIRTTDAALLPRIEAAEHSYLLDPSTATEKLDIRHAVTLKDLLYCCKYGLDPLAEGNCSNMLSTKADYRQFRNEGLPPVAREDLRRCRAVETERGTVLFTQEPDGREACERYMQHHADCFFDPDLGVETLRVYEVEVDPDGFWDKVNPQVLPTAGGMMWVPEHPFVDAEVLRRGYCLKEYDMRATADNFWAFADPQHGENLYVSNGIRDLTGLQIIMQRGYGYLMQNAERYWNREFVFRSGFDNIERKYASDLSDEGRAAKREEQYNLAAYILDRKFPIRRRPSSEIPPMQAEGIRTFRNFDAINLLFRPDKLLEAYQRRRDEPVRGA |
| Ga0244119_106240 | Ga0244119_1062403 | F068811 | MDQDGSEHNICPNREGLCPGKEPHGASGWKKIFQHGKEPLRNKDGVSQYCNKKAAVSLILNENVSETLCIFSIDKTNCCRI |
| Ga0244119_111359 | Ga0244119_1113591 | F055715 | LTKANEFDKINELLIERTAKKFERASKNKLKKFLTNEGFCDKIKELIRVRTAKILDN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |