Sample 3300029468

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300029468

3300029468: Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001965-95

Overview

Basic Information
IMG/M Taxon OID	3300029468 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0133130 \| Gp0283384 \| Ga0244207
Sample Name	Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001965-95
Sequencing Status	Permanent Draft
Sequencing Center	Beijing Genomics Institute (BGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	118842701
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Fecal Microbial Communities From Shanghai Jiao Tong University, China
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location	China: Shanghai
Coordinates	Lat. (^o)	31.2123446	Long. (^o)	121.4684853	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055775	Metagenome	138	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0244207_123182	Not Available	530	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0244207_123182	Ga0244207_1231821	F055775	MAQIAQQDNLVIEVTTTAAALDGDTKKKLIECIEGGTITDVILVTKEVEKKISHARVVSWLVDTTGDSPKYTIDIINANSGAVEAIALN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.