 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029475 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133130 | Gp0283274 | Ga0244097 |
| Sample Name | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001852-102 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 147566792 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Shanghai | |||||||
| Coordinates | Lat. (o) | 31.2123446 | Long. (o) | 121.4684853 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055715 | Metagenome | 138 | N |
| F081453 | Metagenome | 114 | N |
| F089005 | Metagenome | 109 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0244097_100376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis | 58761 | Open in IMG/M |
| Ga0244097_101588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 14345 | Open in IMG/M |
| Ga0244097_103217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 6377 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0244097_100376 | Ga0244097_1003761 | F081453 | AGENIIEKHISANPVCGTNIRAPELAVKGAPGRKCIQ |
| Ga0244097_101588 | Ga0244097_1015881 | F089005 | LTKSKQRSIIALALLRLATSNEESKQALKVRRTLKIEQRDNSKETRNDFEESSKNYSEMY |
| Ga0244097_103217 | Ga0244097_1032176 | F055715 | LTKANEFDKINELLIERTAKKFERASKNKLKKFLTNEKFCDKINELIQVGTAEILDN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |