Sample 3300029534

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300029534

3300029534: Human fecal microbial communities from Shanghai, China - P093V1

Overview

Basic Information
IMG/M Taxon OID	3300029534 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0133133 \| Gp0283628 \| Ga0245005
Sample Name	Human fecal microbial communities from Shanghai, China - P093V1
Sequencing Status	Permanent Draft
Sequencing Center	Beijing Genomics Institute (BGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	96068237
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Fecal Microbial Communities From Shanghai, China
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location	China: Shanghai
Coordinates	Lat. (^o)	31.2112312	Long. (^o)	121.4647709	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054110	Metagenome	140	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0245005_100731	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella	28616	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0245005_100731	Ga0245005_10073113	F054110	MNGRRYVVDTRQSWSKYDKPCKVYIVSRMYNEEEYKLTFPEKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVKTYKGGE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.