NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029606

3300029606: Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 008_6_16_stool_1



Overview

Basic Information
IMG/M Taxon OID3300029606 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133095 | Gp0281899 | Ga0242783
Sample NameHuman feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 008_6_16_stool_1
Sequencing StatusPermanent Draft
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size142040289
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: Baltimore
CoordinatesLat. (o)39.28846264Long. (o)-76.62594594Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056309Metagenome137N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0242783_103963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena6014Open in IMG/M
Ga0242783_108972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena2784Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0242783_103963Ga0242783_1039631F056309LRRMPSLSVVPLLLGDSDSLSVSYGYGMEPEQEALSIVSFKD
Ga0242783_108972Ga0242783_1089724F056309STVKGTKRTCLRRTPSLSVVPLLLGDFDSLSVSYGMEPEQEALSIVSFKD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.