NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029633

3300029633: Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 001_6_7_stool_2



Overview

Basic Information
IMG/M Taxon OID3300029633 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133095 | Gp0281874 | Ga0242758
Sample NameHuman feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 001_6_7_stool_2
Sequencing StatusPermanent Draft
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size95424955
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena3
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: Baltimore
CoordinatesLat. (o)39.28846264Long. (o)-76.62594594Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056309Metagenome137N
F070093Metagenome123N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0242758_100369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena45227Open in IMG/M
Ga0242758_101011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena15898Open in IMG/M
Ga0242758_101180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena13183Open in IMG/M
Ga0242758_106148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1927Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0242758_100369Ga0242758_1003691F056309TCLRRTPSLSVVPLLLGDSGSLSVSYGMEPEQEALSIVSFKD
Ga0242758_101011Ga0242758_10101115F070093VSNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPN
Ga0242758_101180Ga0242758_1011801F056309RRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD
Ga0242758_106148Ga0242758_1061482F056309GTKRMCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFMD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.