Sample 3300029643

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300029643

3300029643: Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35704

Overview

Basic Information
IMG/M Taxon OID	3300029643 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0133139 \| Gp0283861 \| Ga0245225
Sample Name	Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35704
Sequencing Status	Permanent Draft
Sequencing Center	Beijing Genomics Institute (BGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	78912998
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location	United Kingdom: London
Coordinates	Lat. (^o)	51.5	Long. (^o)	-0.12	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032286	Metagenome / Metatranscriptome	180	Y
F055775	Metagenome	138	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0245225_100070	All Organisms → cellular organisms → Bacteria	114840	Open in IMG/M
Ga0245225_100260	Not Available	44318	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0245225_100070	Ga0245225_10007081	F032286	VTSVRHRALVFNTWLFAGNAADDTLVTGGTFRFCRLMCLCVKRRNIMLNDKRRSLLNSALFRADNRTEQKTISLFSLALIFIFDFAALSERRSCPEDRSRRFVPVGTLTLSRSWRLLRWGTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENAPKNADFHAYGQNRKRAEI
Ga0245225_100260	Ga0245225_1002607	F055775	MAQIAQQDNLVIEVSTTAAALDDDTKKKLIECIEGGTITDVILVTKEVEKKISHARVVSWLVDTTGDSPKYTIDIINANSGAVAAIALN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.