x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300029788
3300029788: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 027_10_28_stool_2
Overview
Basic Information
IMG/M Taxon OID 3300029788 Open in IMG/M GOLD Reference Gs0133117 | Gp0282904 | Ga0243743 Sample Name Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 027_10_28_stool_2 Sequencing Status Permanent Draft Sequencing Center Institute for Genome Sciences, University of Maryland School of Medicine Published? N Use Policy Open
Dataset Contents
Total Genome Size 235792127 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii 1 Not Available 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal distal gut
Location Information
Location USA: Baltimore Coordinates Lat. (o ) 39.28846264 Long. (o ) -76.62594594 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F026489 Metagenome 197 N F068856 Metagenome 124 N
Sequences
Scaffold ID Protein ID Family Sequence
Ga0243743_1040987 Ga0243743_10409871 F026489 VEQGRVEEDIAERCSLLTPKENQKSASDFDALEPRKRGCSPLLTPKRWATPKKTEDSRLFGVKIF Ga0243743_1046418 Ga0243743_10464181 F068856 RKGMKRLTSILLALLMLVGMALAEETPDAALGDWYALPSDETVLRLTLREDGTFFFGTEGISGIEGKWRKTTDGEYNLAYTNRSSSLLDVIMSMVDSQAPAPDMTMTARLTESGLDVFYGSTAEGAVVHMARDAEELRTERTPRTDTPLEAFAGTWTMETMFLGTMQLTYTPEMGERQVFCTIDGLTMFPGAGLESFPEGTSFPLTFEDGVLRTTIPLTVQMAASSALVKEIVVDYDLTFFQTADGSLYATLRLSD
