NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029821

3300029821: Groundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig3392



Overview

Basic Information
IMG/M Taxon OID3300029821 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0133313 | Gp0288067 | Ga0246092
Sample NameGroundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig3392
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of California, Berkeley
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size268478502
Sequencing Scaffolds9
Novel Protein Genes9
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini1
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Candidatus Methanoperedenaceae → Candidatus Methanoperedens → Candidatus Methanoperedens nitroreducens1
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameGroundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biome → planetary subsurface zone → groundwater
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationJapan: Horonobe URL
CoordinatesLat. (o)45.045278Long. (o)141.859444Alt. (m)N/ADepth (m)215
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010068Metagenome / Metatranscriptome309Y
F016758Metagenome / Metatranscriptome245Y
F025315Metagenome202Y
F069747Metagenome123Y
F069913Metagenome / Metatranscriptome123Y
F072481Metagenome / Metatranscriptome121Y
F081380Metagenome / Metatranscriptome114Y
F091055Metagenome / Metatranscriptome108N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0246092_1000129All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia198031Open in IMG/M
Ga0246092_1003129All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini11100Open in IMG/M
Ga0246092_1006144All Organisms → cellular organisms → Bacteria5621Open in IMG/M
Ga0246092_1006861All Organisms → cellular organisms → Bacteria5016Open in IMG/M
Ga0246092_1007397All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella4649Open in IMG/M
Ga0246092_1010742All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Candidatus Methanoperedenaceae → Candidatus Methanoperedens → Candidatus Methanoperedens nitroreducens3240Open in IMG/M
Ga0246092_1018411Not Available1899Open in IMG/M
Ga0246092_1019915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1751Open in IMG/M
Ga0246092_1047086All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes695Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0246092_1000129Ga0246092_100012965F069913LTGEEYNLLEEELINSGLDNKSFLTSRWIKLHKYYYWKRKSRDLKEDSLQAEGQFLPIDVHSGGLIKPSKRGKGLKQRFITRGEIEIELRTPSGAELRIRGIMDSLMVSTIIASTGGRRN
Ga0246092_1003129Ga0246092_10031292F091055MIKVVFQYHVTKEKQAEYLQLTQDKIKPFWEANGCQSYTVWQVAESDTGFIKEMLFESGSALKETMALKQANPIKELYFKFATDISRKIVTKKI
Ga0246092_1006144Ga0246092_10061443F081380MNRASEYLNIPDGKRLWLRDFQPHFNSLVLDPIKRFPLQMGDVLIGFVFMSCCIDYLAGFWWGENRGTGMVRQAYTGFINEYFRPRGLYNAKGLYDSLRNGLVHLFTIKDRIYELTFDEPERHLTVSHNGFIILNAGSFRNDLINAANLYFNELKKNPQLLDKAFQRYERDGFVRWID
Ga0246092_1006861Ga0246092_10068619F025315MHNYLLYTCETLLVVVMPLLVLYLKGNWPLRKVILPLVVIPIFWYFTYAPLHELSHAAGIYLVGGKVIFWKLIPSFWLGEFARAWLTPSGITQSWQQLAMSSFPYLLDVVCFIVAIFAFRRGSSRNPFFIGLAFMLLCLRPACDFVFEPIAFLSGDRGDFYAIQQIIGPFAIWSFILISIGLAVYSISLSLIRLNRFSKQQIGQNTDDIKHNIVR
Ga0246092_1007397Ga0246092_10073974F010068MKIKGTFYVTTKTAMTAAFGEERWNSFMAKLSEKDNYFKNVIMSITLIPVEKLIVIFDEMCKEFFNGDYSQYMMFGKVGAKVALSPEGPYKSYLLSKDLKQFVDFALPKLWATYFDGGVCTTKLENNIVHFKVTGVQFKHYYFEQLLMGYFQQSLKVFGKKSVAKQVRGISSGDEDIYFQYALKDS
Ga0246092_1010742Ga0246092_10107426F072481AGVLMLLRLKSNLFGIMIPGSKQSEDMKSRKEGTIPPFHPNLKSEKHVSCKHCGETYKENEIKRDPKSGEWVCKHYPKCEGTGWHSI
Ga0246092_1018411Ga0246092_10184112F025315MPLLVLYRKGNWPLRKIIPSLVVIPVIWYFSYSIVHELSHAAGTYLVGGKVIDYRLIPRFWLGEFRGAWATPGGLTQSWQQLTAHVFPYLMDIVCFVSAILIFRRGSSRNPFVIGIAFMLLCLRPAFNILGETIGLLTGWRGDLYNMQQIVGPFALWSFILFSIGLAIYSTSSTLSHLVRFSKQQIRQNADDTKHNIVQKGEKNDD
Ga0246092_1019915Ga0246092_10199153F016758MNVKGIIYLTGKTTIIKVFGEEPWNVFIAKLGAKDKFFNNMIMSVTPVPLDKFIFFLDELVKEFFNNDMMQYVTFGKVAAQYALSPDGIYKSYLLTKDTKQFIESVMPKFWSTYFDEGTVVTKFENNVAHLKITGLKFKHNYFEHLIMGYFQKALKIFGKKTVAKRIRSMAAGDDDIYYQFEIKES
Ga0246092_1047086Ga0246092_10470861F069747MNKQGRFLDSLTARQYGEVVLPDVSTGKSPGTLAGKLSRCKEGMARVFAVMVQILLRAGALALQV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.