NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029904

3300029904: Fecal microbial communities from Lean line chicken in Harbin, China - MGJ1



Overview

Basic Information
IMG/M Taxon OID3300029904 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0133372 | Gp0289958 | Ga0247319
Sample NameFecal microbial communities from Lean line chicken in Harbin, China - MGJ1
Sequencing StatusPermanent Draft
Sequencing CenterInner Mongolia Agricultural University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size214940855
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses1
All Organisms → cellular organisms → Bacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFecal Microbial Communities From Lean And Fat Line Chickens In Harbin, China
TypeHost-Associated
TaxonomyHost-Associated → Birds → Digestive System → Fecal → Unclassified → Fecal → Fecal Microbial Communities From Lean And Fat Line Chickens In Harbin, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationChina: Harbin
CoordinatesLat. (o)45.73Long. (o)126.73Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036964Metagenome / Metatranscriptome169Y
F047755Metagenome149Y
F053097Metagenome / Metatranscriptome141Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0247319_1000077All Organisms → Viruses98224Open in IMG/M
Ga0247319_1002315All Organisms → cellular organisms → Bacteria11300Open in IMG/M
Ga0247319_1008997All Organisms → cellular organisms → Bacteria3739Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0247319_1000077Ga0247319_1000077150F053097MFDIKGDKIVFSTQDLAIPPFKDFYNNAKDKNLAKKQLEYVVWRYKWNTPYEAYPENERSERVALDVFGAKYEPDASVKELIKRFNEF
Ga0247319_1002315Ga0247319_100231513F036964MISFLKIAFPALMVIGALGSLVVNIISKGDKATSLQWIGASLLYTALLFRNK
Ga0247319_1008997Ga0247319_10089973F047755MQQEKVKYLIDMINNMDIKDKLRLAICMSQSKWSGLIYNTKDYYERFDSMLKDIDEEYRTTLINFEKYKIVMXXXXMAKLMEMETTEQNKVALYLFNDIK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.