NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300031479

3300031479: Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_N_R6 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300031479 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0132857 | Gp0330671 | Ga0314809
Sample NameMetatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_N_R6 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size7800115
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → land → biofilm material
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Pennsylvania
CoordinatesLat. (o)40.7997Long. (o)-77.8629Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022207Metagenome / Metatranscriptome215Y
F073679Metagenome / Metatranscriptome120Y
F077752Metagenome / Metatranscriptome117Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314809_11830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1187Open in IMG/M
Ga0314809_13652Not Available604Open in IMG/M
Ga0314809_14110Not Available533Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314809_11830Ga0314809_118301F077752EKGRFEMTFSFVDSRQIATSLAAALITSLLFVSAATSLPIA
Ga0314809_13652Ga0314809_136522F022207FEGRTALGGIALQPVRLVLLLLVGPREGENDFLEFPSVEEAVAYARELYGERRFQLEGIEDRSGRSVVSYDVLHDRCRAPDRIQERRFG
Ga0314809_14110Ga0314809_141101F073679ASERPEYYRARAAEERHAAACAPTPAIARTHNDLAAMYDRQAREAERERTPEPA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.