NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300031492

3300031492: Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_N_R5 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300031492 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0132857 | Gp0330670 | Ga0314808
Sample NameMetatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_N_R5 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25223767
Sequencing Scaffolds5
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1
Not Available1
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-41
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomelandbiofilm material
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Pennsylvania
CoordinatesLat. (o)40.7997Long. (o)-77.8629Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010911Metagenome / Metatranscriptome297Y
F022207Metagenome / Metatranscriptome215Y
F062141Metagenome / Metatranscriptome131Y
F073679Metagenome / Metatranscriptome120Y
F075461Metagenome / Metatranscriptome119Y
F089547Metagenome / Metatranscriptome109Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314808_100404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi6387Open in IMG/M
Ga0314808_103960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1371Open in IMG/M
Ga0314808_106573Not Available923Open in IMG/M
Ga0314808_107754All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4814Open in IMG/M
Ga0314808_109358All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes701Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314808_100404Ga0314808_1004041F062141MPRGLIFLILVILLLVAGVYFLSQSADEVPVQTIESDITANAATN
Ga0314808_103960Ga0314808_1039601F089547VEIALTALSVALTSSIHVSTYVCLDDTVFALSTSDQMAIVRFKDREYRLPRRQSSIAIKYATEEATLYLDGDFAAFVAEDRWPPGCQRLESGESR
Ga0314808_103960Ga0314808_1039602F073679MASERPEYYRARAAEERHAAACAPTPAIARTHNDLAAMYDRQAREAERERTPEPA
Ga0314808_106573Ga0314808_1065731F022207KLIASAPVTTFEGRTALGGIALQPVRLVLLLLVGPREGENDFLEFPSVEEAVAYARELYGERRFQLEGIEDRSGRSVVSYDVLHDRCRAPDRIQERRFG
Ga0314808_107754Ga0314808_1077541F075461MRYTSTTLALAALLGSAACGVKSKTTDMNPAISRTPTCENAIAVFDGRADVTSNYYELAWIEVEGNSVWTTDNQMRDKMKKRAAEVGANGLISNPVQQNKVGVNVLGEALGARTATARASGLAIWMPGENDRTRLACGTR
Ga0314808_109358Ga0314808_1093581F010911VASLTHLVLTSTVVGDLVSWSVDTGGHVFPAHGGAADEPYPHVVVDRAGVEWSVREVETPQPWARADRCLVLNSRECVRRLWRYPSNWRHLDADALLDLGTAD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.