x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300031497
3300031497: Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_R5 (Metagenome Metatranscriptome)
Overview
Basic Information
IMG/M Taxon OID 3300031497 Open in IMG/M GOLD Reference Gs0132857 | Gp0330676 | Ga0314814 Sample Name Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_R5 (Metagenome Metatranscriptome) Sequencing Status Permanent Draft Sequencing Center DOE Joint Genome Institute (JGI) Published? N Use Policy Open
Dataset Contents
Total Genome Size 11089712 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff 2
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States Type Environmental Taxonomy Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States
Location Information
Location USA: Pennsylvania Coordinates Lat. (o ) 40.7997 Long. (o ) -77.8629 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F042676 Metagenome / Metatranscriptome 157 N F098404 Metagenome / Metatranscriptome 103 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0314814_103994 All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff 648 Open in IMG/M Ga0314814_104284 All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff 611 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0314814_103994 Ga0314814_1039941 F042676 LLHFPHSTTRLSRTHKTHHKMAQQEYSIGGMITFPQLTASYGLISGVIGAASLINPHLCYDLVGQPSRWVPMLESSSGLYTLRLFGLQTVALAAVSLHAAVNVKEPAKRQQLSNVLAALNIGNGLIAAWMYKEGILNPLGVSIHSGLSMALGLGFLVYGLREDRRTGAGEPARD Ga0314814_104284 Ga0314814_1042841 F098404 LDFTHTAMRSFLVCVVLALAISCAAAQQTRPKLSETFESKGFVQIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEVIHVAKDKTPVCHTKSLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPDILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPRECHLGPK
