NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300032014

3300032014: Metatranscriptome of enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Bagasse, Gen9, Rep 3, Penicillin and Streptomycin (Eukaryote Community Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300032014 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118397 | Gp0321451 | Ga0307464
Sample NameMetatranscriptome of enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Bagasse, Gen9, Rep 3, Penicillin and Streptomycin (Eukaryote Community Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size30260223
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Chytridiomycota → Chytridiomycota incertae sedis → Neocallimastigomycetes → Neocallimastigales → Neocallimastigaceae → Neocallimastix1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDetermining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: California
CoordinatesLat. (o)34.4149Long. (o)-119.841Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046107Metagenome / Metatranscriptome151Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0307464_102186All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Chytridiomycota → Chytridiomycota incertae sedis → Neocallimastigomycetes → Neocallimastigales → Neocallimastigaceae → Neocallimastix2601Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0307464_102186Ga0307464_1021861F046107NTMYFGKLYYAGIFPFLTNKKEIKPRSNIFKIDRMVSTKLSPDSLFIELLRRDSPFVEIDDDLVLSLCLISTTSTLLVKFGNLEYLSNNSSNELLMIGIALVKNSAKPTIFGTGDSDELFEK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.