NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300032129

3300032129: Cryopeg brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - CBIW 2018



Overview

Basic Information
IMG/M Taxon OID3300032129 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0133511 | Gp0330626 | Ga0314772
Sample NameCryopeg brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - CBIW 2018
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size160878516
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameExtreme Environments Viral Communities From Various Locations
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Coastal → Unclassified → Cryopeg Brine → Extreme Environments Viral Communities From Various Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → area of sea ice → brine
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Alaska
CoordinatesLat. (o)71.2944Long. (o)-156.7153Alt. (m)N/ADepth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034190Metagenome / Metatranscriptome175Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314772_1040067Not Available771Open in IMG/M
Ga0314772_1045074Not Available700Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314772_1040067Ga0314772_10400671F034190CGGKSDLYDLNGPEISKWIKKECSASVLTAAAVASSAAASTLPDSTRASHSILSRWLEQLHGALLHCRDWTAAEIDAWRSVVTDIQQHWSAEAHSKPFPKLHMLRHSLEFAERHRFLGRASEAQIESFHASFNTLFHDHHLNQGSNTSERLRRCLADASLRAMQPCLSSPSSAPSTPF
Ga0314772_1045074Ga0314772_10450741F034190ASCLLPPLTLVPSASSLREVSSPPLATAPHQTSIPSIALTLGISNRIILDAFSELLGKDRIEAVMKTVTTVHSVGCSGKSDLYDLNGPEISKWIKRECSATLLAAAAEEQSFSSATKATHSVLSRWLQQLHHCLLRSDDWTAADIDSWRSVVSDIHQHWHAETSINAFPKLHMLHHSVDFAERHRFIGRASEAQIESFHASYNALFHKQHRNQSGNIAERLRRCLADAALRA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.