Sample 3300032460

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300032460

3300032460: Metatranscriptome of lab enriched sorghum-adapted microbial communities from California, United States - SM_Day14_2 (Metagenome Metatranscriptome)

Overview

Basic Information
IMG/M Taxon OID	3300032460 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0135754 \| Gp0346128 \| Ga0325395
Sample Name	Metatranscriptome of lab enriched sorghum-adapted microbial communities from California, United States - SM_Day14_2 (Metagenome Metatranscriptome)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	40203945
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Actinotalea → Actinotalea fermentans	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Lab Enriched Sorghum-Adapted Microbial Communities From Joint Bioenergy Institute, Emeryville, California, United States
Type	Host-Associated
Taxonomy	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Plant Biomass → Lab Enriched Sorghum-Adapted Microbial Communities From Joint Bioenergy Institute, Emeryville, California, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Unclassified

Location Information
Location	USA: California
Coordinates	Lat. (^o)	37.8406	Long. (^o)	-122.2901	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014042	Metagenome / Metatranscriptome	266	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0325395_100464	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Actinotalea → Actinotalea fermentans	6110	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0325395_100464	Ga0325395_1004647	F014042	AMRDVGYVVAGYAVTLAMLGAYRWRLAVRTRRARRYLSTATGRTGPAPTGPGRCR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.