NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000010

7000000010: Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765135172



Overview

Basic Information
IMG/M Taxon OID7000000010 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052474 | Ga0031052
Sample NameHuman supragingival plaque microbial communities from NIH, USA - visit 1, subject 765135172
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21014360
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F105377Metagenome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C1264902All Organisms → Viruses574Open in IMG/M
SRS018778_WUGC_scaffold_12106All Organisms → Viruses871Open in IMG/M
SRS018778_WUGC_scaffold_6945All Organisms → Viruses2588Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C1264902C1264902__gene_27233F105377VRNFDKLPLLTPEEAFDRAREEGGSAHPVFDRGYRVRGLDSWKTIETLLCQYDVQDITVASFGLKRFEEILDAIAMLHERGWHLWQTSANVYVDGEKRTVQAIRARYRVI
SRS018778_WUGC_scaffold_12106SRS018778_WUGC_scaffold_12106__gene_11800F105377VRAEMRDFDKLPLLTPEEAFERAMEMGWNRLLFDHGYRVRGLNDWKGIETLLRQYDVDDAVIASFGLKRFEEIFDVFAMLSDRGWSLWQTSANVYVDGELRTVPAIRAHYCGD
SRS018778_WUGC_scaffold_6945SRS018778_WUGC_scaffold_6945__gene_5617F105377VRDFDSLPLLTPEEAFERAREMGWDLPLFDHGYRVRGLEAWKAIETLLRQYDVEDLVIASFGLKGIEEIFDAFAMLHERGWRLWQTTAKVYVGGELRTVQAIRARYRDV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.