 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000082 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052558 | Ga0031042 |
| Sample Name | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159207311 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 75678192 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1 |
| All Organisms → Viruses → Predicted Viral | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F101360 | Metagenome | 102 | N |
| F103434 | Metagenome | 101 | N |
| F105377 | Metagenome | 100 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| SRS017304_Baylor_scaffold_3012 | All Organisms → Viruses | 17804 | Open in IMG/M |
| SRS017304_Baylor_scaffold_30367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 33949 | Open in IMG/M |
| SRS017304_Baylor_scaffold_9667 | All Organisms → Viruses → Predicted Viral | 1446 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| SRS017304_Baylor_scaffold_3012 | SRS017304_Baylor_scaffold_3012__gene_4416 | F105377 | MEVRSEVRDFDDLPLLTPEEAFERAWEEGGSAHPVFDRGYRIRDLSSWKAVETLLRQNDVPDITVASFGLKRFEEILDAIAMLHERGWHLWQTATNVYVGGERRTVQAIRAHYRGD |
| SRS017304_Baylor_scaffold_30367 | SRS017304_Baylor_scaffold_30367__gene_46565 | F103434 | VVEVTLAVVKEGRTGRRFERGDTFTIDKVLVQPSAGNALKATENRVIRGDLTDETILKIFGTGRKWPGGPHSWVKIIKGPDSLVGKTFQQAGEPLTYDASPMTRHWSVRCDTLGTESR |
| SRS017304_Baylor_scaffold_9667 | SRS017304_Baylor_scaffold_9667__gene_13722 | F101360 | MSKEDALRRAAVAAHVAKVASQEKKRALAELEEVMAPGDTSRPMIDGLQIGTVSVSSPAPKYQVVDEGALVAWLEWNKPDAVHKVPAPWFTSAAALDGFIKQTGEIPDGVEVVKGDPRISVRISTAQADAIQELIESGDIRMIEAAGD |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |