NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000136

7000000136: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159207311



Overview

Basic Information
IMG/M Taxon OID7000000136 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052632 | Ga0027923
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 159207311
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size23334242
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071328Metagenome122N
F077404Metagenome117N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
SRS013506_Baylor_scaffold_2658All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella9276Open in IMG/M
SRS013506_Baylor_scaffold_7056All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4224Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
SRS013506_Baylor_scaffold_2658SRS013506_Baylor_scaffold_2658__gene_3903F077404MNILKTTFAFFFALCFMMGANCYAQKTESIDAEASKRELKRNAIYIPPALEEYADTTLLHQRFNVENKGNYLYTPFTKDNEPSIPFNYGFLHPLDERFYNCFMGKVDRILRPKEDKGFIILTNYLVVLDDKYAFDASNKDTSKLADLKYLDFRRIKSDFSYGHPYQGFTDNDRVELSNFVQSYGRQAALETANAWVMASYPFSLQSTKFENLYTRGRKLILTDGKTTLYLYFLMIDSVALNFDTEVLPYIKGVFRFNRVR
SRS013506_Baylor_scaffold_7056SRS013506_Baylor_scaffold_7056__gene_9984F071328MEKNKSKLSNIARMAAEAFTGLICHVNKDCKMSQKHWTFTNIIRYIEDYKKNPQLIERMKWEFISEGECIVEFVKLYKHLVLERTIDPKIHQTTAIYLRYSQQLLLKKKRAIRRLGIGKKNVSAILRLCGIHYREYGDDEHRVFFLDTDVNIYFCKHYQLPIYILQRIEFSNKEYRSFILKVLPVKKSEW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.