NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000183

7000000183: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159551223



Overview

Basic Information
IMG/M Taxon OID7000000183 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052688 | Ga0027956
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 159551223
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21628728
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Alloprevotella → Alloprevotella sp. oral taxon 473 → Alloprevotella sp. oral taxon 473 str. F00401

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077404Metagenome117N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C1117285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Alloprevotella → Alloprevotella sp. oral taxon 473 → Alloprevotella sp. oral taxon 473 str. F00401954Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C1117285C1117285__gene_34758F077404MAQQIILTHKLAAAALSLKEPTQIGNTKNPFAMNILKTAFAFFFALCFMMGANSYAQTTVRINAEASKRELKKNAVYLPPALEEYADTILLHQRFIVENKGNYLYTPFTKDNEPSIPFNYGFLHPLGERFYNSFMGKVDRILRPKEDKGFIILTNYLVVLDDKYAFDTSNKDTSKLADLKYLDFRRIKSDFSYGHPYQGFTDYDRVELSNFVQSYGRQAALETANAWVMASYPFSLQSTKFENLYTRGRKLILTDGKTTLSLYFLMIDSVALNFDTKVLPYIKGVFRFNRIR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.