Basic Information | |
---|---|
IMG/M Taxon OID | 7000000358 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052902 | Ga0031030 |
Sample Name | Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764447348 |
Sequencing Status | Permanent Draft |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 66138844 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 4 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cardiobacteriales → Cardiobacteriaceae → Cardiobacterium → unclassified Cardiobacterium → Cardiobacterium sp. | 1 |
All Organisms → cellular organisms → Bacteria | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F049707 | Metagenome | 146 | N |
F063777 | Metagenome | 129 | N |
F097526 | Metagenome | 104 | Y |
F101359 | Metagenome | 102 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
C2108872 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 502 | Open in IMG/M |
C2175681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cardiobacteriales → Cardiobacteriaceae → Cardiobacterium → unclassified Cardiobacterium → Cardiobacterium sp. | 2596 | Open in IMG/M |
C2177907 | All Organisms → cellular organisms → Bacteria | 3539 | Open in IMG/M |
SRS015989_WUGC_scaffold_13220 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1541 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
C2108872 | C2108872__gene_82959 | F101359 | MKKFLSKRSILVGALALVLGFIVSSCSRDKDDDAIYTAKLQVQHHSNNSRNSTANGSVTYRDANGNKRKIYLRSGMSESISFEVNKGFKSFVEVKATDIYGNLFVKWTVTKTYTGARVQNWS |
C2175681 | C2175681__gene_108667 | F097526 | MQHFSAQPDGTAAITPYTQDDYRRLCERLDDDTVAALLHAHIDAFAADGNRQLLKRLTEAMHIAAEFEQAGRNGHPDSEEQTRRAYWDCHFAALQQHARMAGNQITNADNAAVSRLTRQCEKNGSCDTAIPSPHDDDYGFAAALRDIPLNEKQTALLWRMALLTIAEMMDAVPSLVAHYLNGIGGEHLGRALAGKTVYPVTVVSNLAWLLHEQQKSGQLQRDLWHSAAALGSGDAEVREKPQ |
C2177907 | C2177907__gene_110122 | F049707 | VVSEYRSPHNDGHDPYILIWEYGNDIRRAEFSERWAEYDETGWTVWYFRLVDGGIMTFSSREWEQKDDVNHLTTIWMRPSLYDIERKAS |
SRS015989_WUGC_scaffold_13220 | SRS015989_WUGC_scaffold_13220__gene_19022 | F063777 | MKVLNIKISALPPENNSFWMKLLLYLCIPFLFIFGILFLIGWGIYSGINSIISAVKEDFFGIKDKTNIKTSKNILLENEQFKLKKEDYLPDENSQKYKIFEDFCAKSNEYLDDGYVFYKLTDEKSATDLNGAIISEFQEDIGNYILLQNLILEDNQLKNQLISFNKNTGKIIVLADIKDFFWLDFDSETKTINGYNNKEQIEVAISE |
⦗Top⦘ |