 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000444 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052994 | Ga0030602 |
| Sample Name | Human stool microbial communities from NIH, USA - visit 2, subject 763901136 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 133303628 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 5 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F044554 | Metagenome | 154 | N |
| F078004 | Metagenome | 117 | N |
| F078822 | Metagenome | 116 | N |
| F092227 | Metagenome | 107 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| C2581986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2645 | Open in IMG/M |
| SRS063985_LANL_scaffold_22860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1037 | Open in IMG/M |
| SRS063985_LANL_scaffold_48934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1793 | Open in IMG/M |
| SRS063985_LANL_scaffold_5254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1620 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| C2581986 | C2581986__gene_207421 | F078822 | HFFDIFLSFPNAFSKAFHPYAVRFPAAFLLVHRFYLAFEELLSCVTAYL |
| SRS063985_LANL_scaffold_22860 | SRS063985_LANL_scaffold_22860__gene_37759 | F092227 | YSMNEQKHKRWLRIGCLVLAGVFALSLLSSVIMMLLY |
| SRS063985_LANL_scaffold_24474 | SRS063985_LANL_scaffold_24474__gene_40635 | F078004 | MVLFPVCFLFFCKSSTGGLSAVAGSAALDVHMLRHTLIITIINALYCLTVDADRMAWMRQGIAERFSSLSLLRKAFTAGSVTVAGVLATHHDVSLATQTVLIIGTIFHNAF |
| SRS063985_LANL_scaffold_48934 | SRS063985_LANL_scaffold_48934__gene_92989 | F044554 | RSASPCIFFHTQAYVLAGRFIPVLCASIARLFPCRTEIARCLTLDFAISRYLFLSFSFSFRTNFAQALFSSLLFASDTRAKSILFLLFENEIAHLQGQYRFNSHRYCFSAFLVL |
| SRS063985_LANL_scaffold_5254 | SRS063985_LANL_scaffold_5254__gene_6377 | F092227 | YSMNEQKHKRLLRIGCLLLAGLFALSLLGSVLMMLLF |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |