x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 7000000525
7000000525: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 763496533
Overview
Basic Information
IMG/M Taxon OID 7000000525 Open in IMG/M GOLD Reference Gs0063646 | Gp0053079 | Ga0027970 Sample Name Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 763496533 Sequencing Status Permanent Draft Sequencing Center Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis Published? N Use Policy Open
Dataset Contents
Total Genome Size 36007195 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas 1 All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctHip2 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
Location Information
Location USA: Maryland: Natonal Institute of Health Coordinates Lat. (o ) 39.0042816 Long. (o ) -77.1012173 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F051213 Metagenome 144 N F105380 Metagenome 100 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link C1374310 All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas 511 Open in IMG/M C1407755 All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctHip2 6492 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
C1374310 C1374310__gene_43126 F051213 KPKTHSGIKTLMKASKLLWAVVMALTFVLTSCDPFSKNEPTIEGDRYKYFDSSAQRQSFRVVNGSGKQYNRKVDWHIIGIQEENSDTYLTKKVDTLSNGDFRISYDWVTFTAKENKSVIDVEVQKNETGKDRSVFFATSNSYKQAYLPNMIVTQRAK C1407755 C1407755__gene_61519 F105380 MSILELDSSQYVKQGRIFKKFDSALLDSYMDGRQTEYSINLSELDDQISDGIVYADHEGKMIYKFGAKKILQTAITNGLTITGLASEFKMKHYSFWVPDLYFISYSSFNPNSDLYIAYRSKDAKKICLTNIWSGSGNVDFYSPNGGRLVYNRLCKGRMMDDIGTDDYEAWKRTSVNRASNFVNKFISARGNSDLDFISNPIRSNVANNIKGYAEFLASITKEQENVNTYEEFIEWTKNTNWLK
