Sample 7000000597

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 7000000597

7000000597: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 763961826

Overview

Basic Information
IMG/M Taxon OID	7000000597 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0063646 \| Gp0053169 \| Ga0027968
Sample Name	Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 763961826
Sequencing Status	Permanent Draft
Sequencing Center	Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	10267484
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal surface

Location Information
Location	USA: Maryland: Natonal Institute of Health
Coordinates	Lat. (^o)	39.0042816	Long. (^o)	-77.1012173	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027205	Metagenome	195	N
F036281	Metagenome	170	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
C920102	All Organisms → Viruses → Predicted Viral	1729	Open in IMG/M
C920186	All Organisms → Viruses → Predicted Viral	3335	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
C920102	C920102__gene_33066	F036281	YLAKLKETDGVMLPTFIYRNKDLFVTEFKPTCDDQWIMYMTNAEGLITKMRIKNGDLMSNGSVLFLAEERKTYSYKEYFDYWTAREGRPAPFFYESRQYHVKSFMRVPGMPELLITAEREKDHWYTFRLSDGLKSKFTRHTITNEKGHQSYDWVLKNAQWELDTIRYF
C920186	C920186__gene_33182	F027205	VASRLIVSADDILRAVKESEEFERKALVEAQKRDRAAGKKPREVLHPDHKPGREIVLDYIKNPERRRTPRCSVHLEKRTANNSYRFVVDVSQVRNRELADEIEKDLFAFMDYLLDEYDIPRRIRK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.