NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000621

7000000621: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159268001



Overview

Basic Information
IMG/M Taxon OID7000000621 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0063646 | Gp0053195 | Ga0027924
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 159268001
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21373229
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationNational Institutes of Health, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040149Metagenome162N
F043235Metagenome156N
F090517Metagenome108N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C1749332All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas bobii553Open in IMG/M
C1758406All Organisms → cellular organisms → Bacteria740Open in IMG/M
C1760036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales800Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C1749332C1749332__gene_33322F090517MNRRIFSFCGLLLGLLFLASSCKKDTPLPPQLSEGELRQTVWNGTLEYKNAKRGSYSVYLNFLSDSEVEVSAYDSKDPTDPYYVQARYYYTLTDRIFTLKTQVDYELNPPMDKNTWYLIRKEPSLLVFQANAGNPAAEATLTLRKK
C1758406C1758406__gene_38899F040149VADEGAEELRWKVLIKEQGIPVLFVEVEAWYDGRVSSSEILRSVGIALEREPQLTPVWSHDSEDAIHDFIYDTSVPKGHTLTAVRERETVVAQLLNIHRYVYYP
C1760036C1760036__gene_39984F043235GIGDRPDTDLKRISVVDEFGTQLTDALLDRPDRSKRKLHQGAVNGDDIVQLRHMDEVVPSDEGHLLIDLCDDDPRSLCGGLGIVTRYPEGAIALFIGLAHRDQCDIDRIDTIPKEVWEFMEVTREIVDTLIQVSGAAILVKEVKDGMYMPHHLWAEVPRLGKVQHVEGFHVREALAIIVEGFGETAGGCHSMAKDQEVPALYCRSHGFKGGRSMASNVLLPGSAH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.