 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000623 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0053197 | Ga0028025 |
| Sample Name | Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 246515023 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 32104366 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | National Institutes of Health, USA | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036281 | Metagenome | 170 | N |
| F105378 | Metagenome | 100 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| SRS057022_LANL_scaffold_28052 | Not Available | 1010 | Open in IMG/M |
| SRS057022_LANL_scaffold_35328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8910 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| SRS057022_LANL_scaffold_28052 | SRS057022_LANL_scaffold_28052__gene_30490 | F105378 | MNVKVYVDKIKKWVQISSDEVLDVNKNLSDLKDKEAAITNLGLYEKFISKEALESGFLPDVFTPDNIVTDSIHQFVTDEEKNKWNNKLNVPVPMQDHLANNQIGYDSVNSKFYIGLNNQNVLLGGSSCFDNIIVVNGFFSGNSQPTVIRNNKFNEAGQLITPVFVDVQCVEYTAGDLGEVSVSYTTDAISIYNTGSFTGSFQCLIVYPLGSVNE |
| SRS057022_LANL_scaffold_35328 | SRS057022_LANL_scaffold_35328__gene_41945 | F036281 | MITLIKVDEGPVDIYELRMQYLAKLKETDGVMLPTFIYRNKELFVTEFKPTCDDQWIMYMTNVDGLITKMRIKNGDLMSNGSVLFLAEERKTYNAKEYYDYWTAREGKPAPFFYESRQYHVKSFMRVPGSTDLWITAERETGHWYTFRLSDDLKSKFTRHTITNEKGHQSYDWVLKNVEWAADTIRYF |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |