 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000715 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0053300 | Ga0030481 |
| Sample Name | Human stool microbial communities from NIH, USA - visit 1, subject 763961826 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 98941511 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | National Institutes of Health, USA | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F044554 | Metagenome | 154 | N |
| F047125 | Metagenome / Metatranscriptome | 150 | N |
| F090515 | Metagenome | 108 | N |
| F099269 | Metagenome | 103 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| C1569856 | Not Available | 527 | Open in IMG/M |
| SRS014683_WUGC_scaffold_11151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella | 673 | Open in IMG/M |
| SRS014683_WUGC_scaffold_22273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 648 | Open in IMG/M |
| SRS014683_WUGC_scaffold_43912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis | 537 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| C1569856 | C1569856__gene_121300 | F044554 | VLAGRFIPVLCTSIARLFPCRTEIARCLTLDFAISRYLFLSFSFSFRTNFAQALFSSLLFVSDTRAKSILFLLFENEIAHLQGQYRFNSHRYCFSAFLVL |
| SRS014683_WUGC_scaffold_11151 | SRS014683_WUGC_scaffold_11151__gene_15973 | F099269 | VQVGELLLFDDLGDRASGASVLASATGDAGVLVSDGSDVLELQNASGAGVDANATSDALVGINYGMSHGSFLSVDRRYRRCAPV |
| SRS014683_WUGC_scaffold_22273 | SRS014683_WUGC_scaffold_22273__gene_31979 | F047125 | MDVALLLMVLGVMLSGFWAADALDRMRKEILRQEGKRRGWWS |
| SRS014683_WUGC_scaffold_43912 | SRS014683_WUGC_scaffold_43912__gene_67181 | F090515 | RVACLEFAGGEKRKTNIAADYAVKALAFTALLCRHIGSIRTFLKS |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |