NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F000787

Metagenome / Metatranscriptome Family F000787

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F000787
Family Type Metagenome / Metatranscriptome
Number of Sequences 891
Average Sequence Length 117 residues
Representative Sequence MKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Number of Associated Samples 528
Number of Associated Scaffolds 889

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.67 %
% of genes near scaffold ends (potentially truncated) 52.41 %
% of genes from short scaffolds (< 2000 bps) 99.89 %
Associated GOLD sequencing projects 473
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.327 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(32.884 % of family members)
Environment Ontology (ENVO) Unclassified
(62.851 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(79.012 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 26.57%    β-sheet: 1.40%    Coil/Unstructured: 72.03%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 889 Family Scaffolds
PF01248Ribosomal_L7Ae 0.22
PF01165Ribosomal_S21 0.11
PF13631Cytochrom_B_N_2 0.11

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 889 Family Scaffolds
COG1358Ribosomal protein L7Ae or related RNA K-turn-binding proteinTranslation, ribosomal structure and biogenesis [J] 0.22
COG1911Ribosomal protein L30ETranslation, ribosomal structure and biogenesis [J] 0.22
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 0.11


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.89 %
UnclassifiedrootN/A0.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2236876011|none_p101647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300000116|DelMOSpr2010_c10208903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani620Open in IMG/M
3300000117|DelMOWin2010_c10138055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani823Open in IMG/M
3300000117|DelMOWin2010_c10159752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani734Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10115398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani817Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10062628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1477Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10115026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani943Open in IMG/M
3300000736|JGI12547J11936_1055836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani786Open in IMG/M
3300001354|JGI20155J14468_10066636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1414Open in IMG/M
3300001354|JGI20155J14468_10102502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1004Open in IMG/M
3300001354|JGI20155J14468_10133458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani817Open in IMG/M
3300001354|JGI20155J14468_10136214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani804Open in IMG/M
3300001354|JGI20155J14468_10155279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani727Open in IMG/M
3300001355|JGI20158J14315_10123185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani839Open in IMG/M
3300001848|RCM47_1085082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300002349|B570J29580_105462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani733Open in IMG/M
3300002835|B570J40625_100833361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → Mycoplasma → Mycoplasma haemocanis806Open in IMG/M
3300002835|B570J40625_101016227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Mycoplasmatales → Mycoplasmataceae → Mycoplasma → Mycoplasma haemocanis707Open in IMG/M
3300003216|JGI26079J46598_1047529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani883Open in IMG/M
3300003555|Ga0008453J51685_105370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300003677|Ga0008458J53046_101047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300003681|Ga0008457_1008974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300003683|Ga0008459J53047_1001815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300003683|Ga0008459J53047_1040302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300003701|Ga0005233J53080_1022365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300003787|Ga0007811_1020491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300003798|Ga0007842_1012612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300003802|Ga0007840_1009913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300003821|Ga0007843_106497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300003860|Ga0031658_1032167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani890Open in IMG/M
3300003860|Ga0031658_1044733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300004097|Ga0055584_100986099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani881Open in IMG/M
3300004097|Ga0055584_102009660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300004507|Ga0008280_1013960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300004685|Ga0065177_1084517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300004689|Ga0065172_1003932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani865Open in IMG/M
3300004690|Ga0065175_1016302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300004769|Ga0007748_10090130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani567Open in IMG/M
3300004784|Ga0007744_1326740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300004786|Ga0007753_1476393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300004789|Ga0007752_10168152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1728Open in IMG/M
3300004790|Ga0007758_10005100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300005433|Ga0066830_10042751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani920Open in IMG/M
3300005433|Ga0066830_10060993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani779Open in IMG/M
3300005433|Ga0066830_10152253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300005516|Ga0066831_10053575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1091Open in IMG/M
3300005584|Ga0049082_10203727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300005584|Ga0049082_10217756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300005585|Ga0049084_10306816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300005599|Ga0066841_10079039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300005608|Ga0066840_10086339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani647Open in IMG/M
3300005608|Ga0066840_10088728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300005662|Ga0078894_10822866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani811Open in IMG/M
3300005980|Ga0066798_10136588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani692Open in IMG/M
3300006071|Ga0007876_1072150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani913Open in IMG/M
3300006355|Ga0075501_1337925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani620Open in IMG/M
3300006357|Ga0075502_1666896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300006374|Ga0075512_1277113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300006390|Ga0075509_1526114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300006396|Ga0075493_1576690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani660Open in IMG/M
3300006397|Ga0075488_1034157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300006399|Ga0075495_1604218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani663Open in IMG/M
3300006401|Ga0075506_1721161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300006403|Ga0075514_1001433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300006404|Ga0075515_10009654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300006641|Ga0075471_10120256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1402Open in IMG/M
3300006641|Ga0075471_10371848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani720Open in IMG/M
3300006728|Ga0031676_1005626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300006803|Ga0075467_10143034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1380Open in IMG/M
3300006803|Ga0075467_10396170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani719Open in IMG/M
3300006803|Ga0075467_10446247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300006875|Ga0075473_10088025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1225Open in IMG/M
3300007231|Ga0075469_10101300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani809Open in IMG/M
3300007513|Ga0105019_1204937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani968Open in IMG/M
3300007513|Ga0105019_1242264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani837Open in IMG/M
3300007513|Ga0105019_1246006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani824Open in IMG/M
3300007523|Ga0105052_11034435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300007552|Ga0102818_1055295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani782Open in IMG/M
3300007552|Ga0102818_1065289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani717Open in IMG/M
3300007552|Ga0102818_1092942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300007558|Ga0102822_1109825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani649Open in IMG/M
3300007558|Ga0102822_1154418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300007623|Ga0102948_1173162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300007629|Ga0102895_1185638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300007655|Ga0102825_1070208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani713Open in IMG/M
3300007667|Ga0102910_1133551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300007715|Ga0102827_1094146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani676Open in IMG/M
3300007718|Ga0102852_1045155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani833Open in IMG/M
3300007725|Ga0102951_1120421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani741Open in IMG/M
3300007862|Ga0105737_1098338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani738Open in IMG/M
3300007863|Ga0105744_1058465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani951Open in IMG/M
3300007863|Ga0105744_1062410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani918Open in IMG/M
3300007981|Ga0102904_1125308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani604Open in IMG/M
3300008110|Ga0114343_1182763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani629Open in IMG/M
3300008261|Ga0114336_1360643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300008832|Ga0103951_10713384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani547Open in IMG/M
3300008832|Ga0103951_10818467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300008929|Ga0103732_1062022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300008931|Ga0103734_1038770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani719Open in IMG/M
3300008935|Ga0103738_1019650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani891Open in IMG/M
3300008993|Ga0104258_1069424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300008993|Ga0104258_1109836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300008993|Ga0104258_1110987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300008993|Ga0104258_1115222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300008995|Ga0102888_1114466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300008999|Ga0102816_1254517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300009000|Ga0102960_1312757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300009001|Ga0102963_1191900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani816Open in IMG/M
3300009001|Ga0102963_1203404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani789Open in IMG/M
3300009003|Ga0102813_1117146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani843Open in IMG/M
3300009003|Ga0102813_1186574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani643Open in IMG/M
3300009022|Ga0103706_10160345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300009022|Ga0103706_10178178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300009025|Ga0103707_10071508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300009025|Ga0103707_10122678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300009025|Ga0103707_10140586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300009028|Ga0103708_100112574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani698Open in IMG/M
3300009028|Ga0103708_100237069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300009059|Ga0102830_1170080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300009071|Ga0115566_10380255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani817Open in IMG/M
3300009071|Ga0115566_10440811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani745Open in IMG/M
3300009077|Ga0115552_1328188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani608Open in IMG/M
3300009079|Ga0102814_10366743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani783Open in IMG/M
3300009079|Ga0102814_10422256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani726Open in IMG/M
3300009080|Ga0102815_10608615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani614Open in IMG/M
3300009124|Ga0118687_10081860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1102Open in IMG/M
3300009172|Ga0114995_10662684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300009182|Ga0114959_10368633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300009195|Ga0103743_1028464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani798Open in IMG/M
3300009263|Ga0103872_1010352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani951Open in IMG/M
3300009263|Ga0103872_1048082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani619Open in IMG/M
3300009263|Ga0103872_1071597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300009263|Ga0103872_1072805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300009402|Ga0103742_1010106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1078Open in IMG/M
3300009432|Ga0115005_10273352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1326Open in IMG/M
3300009432|Ga0115005_10479370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani991Open in IMG/M
3300009432|Ga0115005_10588815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani890Open in IMG/M
3300009432|Ga0115005_10597998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani883Open in IMG/M
3300009432|Ga0115005_10631340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani858Open in IMG/M
3300009432|Ga0115005_10660978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani838Open in IMG/M
3300009432|Ga0115005_10813547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani752Open in IMG/M
3300009432|Ga0115005_10856419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani733Open in IMG/M
3300009432|Ga0115005_11015922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani671Open in IMG/M
3300009432|Ga0115005_11312570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300009432|Ga0115005_11569818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300009433|Ga0115545_1217290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani648Open in IMG/M
3300009434|Ga0115562_1103804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1121Open in IMG/M
3300009434|Ga0115562_1205143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300009434|Ga0115562_1315432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300009436|Ga0115008_10126032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1881Open in IMG/M
3300009436|Ga0115008_10446065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani921Open in IMG/M
3300009436|Ga0115008_10467449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani899Open in IMG/M
3300009440|Ga0115561_1209153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani740Open in IMG/M
3300009441|Ga0115007_10530216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani779Open in IMG/M
3300009441|Ga0115007_10632931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani714Open in IMG/M
3300009441|Ga0115007_11274008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300009442|Ga0115563_1214768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani732Open in IMG/M
3300009443|Ga0115557_1220885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani735Open in IMG/M
3300009447|Ga0115560_1176204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani838Open in IMG/M
3300009447|Ga0115560_1186736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani809Open in IMG/M
3300009466|Ga0126448_1075799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani765Open in IMG/M
3300009467|Ga0115565_10433702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300009497|Ga0115569_10349100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani644Open in IMG/M
3300009507|Ga0115572_10183760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1215Open in IMG/M
3300009508|Ga0115567_10765938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300009538|Ga0129287_10077194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1406Open in IMG/M
3300009543|Ga0115099_10823166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300009543|Ga0115099_10894111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani604Open in IMG/M
3300009544|Ga0115006_11131846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani698Open in IMG/M
3300009550|Ga0115013_10524622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani778Open in IMG/M
3300009592|Ga0115101_1353856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani756Open in IMG/M
3300009593|Ga0115011_10627012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani870Open in IMG/M
3300009599|Ga0115103_1158614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani681Open in IMG/M
3300009599|Ga0115103_1480423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300009599|Ga0115103_1875591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300009606|Ga0115102_10018583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300009606|Ga0115102_10897636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani569Open in IMG/M
3300009606|Ga0115102_10985582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300009677|Ga0115104_10296898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani603Open in IMG/M
3300009679|Ga0115105_10182043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300009679|Ga0115105_10808078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300009679|Ga0115105_11413053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300009705|Ga0115000_10829225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani567Open in IMG/M
3300009728|Ga0123371_144794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300010158|Ga0114960_10307664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani794Open in IMG/M
3300010296|Ga0129348_1130979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani874Open in IMG/M
3300010354|Ga0129333_11017381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani696Open in IMG/M
3300010354|Ga0129333_11756193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300010368|Ga0129324_10174714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani883Open in IMG/M
3300010368|Ga0129324_10197859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani817Open in IMG/M
3300010981|Ga0138316_10653832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300010981|Ga0138316_10653832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300010987|Ga0138324_10617790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300010987|Ga0138324_10627227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300010987|Ga0138324_10629522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300010987|Ga0138324_10683811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300012036|Ga0136600_1029254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1348Open in IMG/M
3300012036|Ga0136600_1066022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani825Open in IMG/M
3300012408|Ga0138265_1357292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300012415|Ga0138263_1189161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300012415|Ga0138263_1280391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300012416|Ga0138259_1369124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300012416|Ga0138259_1583698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300012471|Ga0129334_1004272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300012471|Ga0129334_1043150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300012516|Ga0129325_1142261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300012516|Ga0129325_1159134All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300012516|Ga0129325_1333162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300012525|Ga0129353_1681397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300012705|Ga0157555_1088074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300012709|Ga0157608_1039534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani547Open in IMG/M
3300012715|Ga0157599_1191021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300012716|Ga0157605_1052108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani655Open in IMG/M
3300012771|Ga0138270_1053440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300012920|Ga0160423_10446729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani881Open in IMG/M
3300012920|Ga0160423_10451196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani876Open in IMG/M
3300012928|Ga0163110_11428813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300012952|Ga0163180_10925129All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300012953|Ga0163179_10132043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1845Open in IMG/M
3300012953|Ga0163179_10315544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1241Open in IMG/M
3300012953|Ga0163179_10555986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani957Open in IMG/M
3300012953|Ga0163179_10592683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani929Open in IMG/M
3300012953|Ga0163179_10647928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani891Open in IMG/M
3300012953|Ga0163179_10715567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani851Open in IMG/M
3300012954|Ga0163111_11335204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300012954|Ga0163111_12090302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani571Open in IMG/M
3300012962|Ga0129335_1190223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300012966|Ga0129341_1001077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani784Open in IMG/M
3300012968|Ga0129337_1216037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani961Open in IMG/M
3300012968|Ga0129337_1274879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300012970|Ga0129338_1009143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300012970|Ga0129338_1010382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300012970|Ga0129338_1032746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300013115|Ga0171651_1127138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani823Open in IMG/M
3300013295|Ga0170791_12624955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300016697|Ga0180057_1043504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300016726|Ga0182045_1315162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300016729|Ga0182056_1350766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300016737|Ga0182047_1238500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300016739|Ga0182076_1177421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300016740|Ga0182096_1206849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300016741|Ga0182079_1089568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300016746|Ga0182055_1405216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani594Open in IMG/M
3300016749|Ga0182053_1088123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani571Open in IMG/M
3300016758|Ga0182070_1131777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300016882|Ga0186577_104700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1060Open in IMG/M
3300017280|Ga0186684_118370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani606Open in IMG/M
3300017697|Ga0180120_10230209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani758Open in IMG/M
3300017709|Ga0181387_1027560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1110Open in IMG/M
3300017713|Ga0181391_1082456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani734Open in IMG/M
3300017738|Ga0181428_1147858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300017738|Ga0181428_1165994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300017753|Ga0181407_1097702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani741Open in IMG/M
3300017755|Ga0181411_1165615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani632Open in IMG/M
3300017757|Ga0181420_1125771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani777Open in IMG/M
3300017763|Ga0181410_1226526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300017764|Ga0181385_1164032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300017765|Ga0181413_1161497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani674Open in IMG/M
3300017767|Ga0181406_1093733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani911Open in IMG/M
3300017767|Ga0181406_1224879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300017768|Ga0187220_1090174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani925Open in IMG/M
3300017768|Ga0187220_1195796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300017772|Ga0181430_1084044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani958Open in IMG/M
3300017782|Ga0181380_1235622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300017783|Ga0181379_1126036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani924Open in IMG/M
3300017949|Ga0181584_10171443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1443Open in IMG/M
3300017951|Ga0181577_10431275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani834Open in IMG/M
3300017951|Ga0181577_10447056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani816Open in IMG/M
3300017951|Ga0181577_10492680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani768Open in IMG/M
3300017956|Ga0181580_10631781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani687Open in IMG/M
3300017957|Ga0181571_10420649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani825Open in IMG/M
3300017964|Ga0181589_10857230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300017967|Ga0181590_10676130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani698Open in IMG/M
3300017968|Ga0181587_10660331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani663Open in IMG/M
3300017986|Ga0181569_10442078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani885Open in IMG/M
3300017986|Ga0181569_10443843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani883Open in IMG/M
3300017986|Ga0181569_10450388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani875Open in IMG/M
3300018039|Ga0181579_10423818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani715Open in IMG/M
3300018039|Ga0181579_10481130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300018410|Ga0181561_10297859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani752Open in IMG/M
3300018413|Ga0181560_10299780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani752Open in IMG/M
3300018418|Ga0181567_10547407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani752Open in IMG/M
3300018420|Ga0181563_10427848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani752Open in IMG/M
3300018421|Ga0181592_10426001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani932Open in IMG/M
3300018421|Ga0181592_10790757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300018424|Ga0181591_10849690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani630Open in IMG/M
3300018515|Ga0192960_105807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani588Open in IMG/M
3300018567|Ga0188858_109506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300018575|Ga0193474_1018186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300018596|Ga0193060_1018719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300018602|Ga0193182_1025194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300018603|Ga0192881_1024105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300018605|Ga0193339_1029185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300018609|Ga0192959_1044993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300018617|Ga0193133_1022947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300018618|Ga0193204_1020281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300018625|Ga0192842_1037475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300018628|Ga0193355_1023468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300018628|Ga0193355_1024610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300018628|Ga0193355_1024777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300018628|Ga0193355_1025160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300018628|Ga0193355_1025271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani565Open in IMG/M
3300018628|Ga0193355_1026424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300018628|Ga0193355_1027121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300018628|Ga0193355_1031538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300018628|Ga0193355_1032046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300018653|Ga0193504_1032482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300018655|Ga0192846_1033533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300018655|Ga0192846_1035052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300018658|Ga0192906_1041218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300018661|Ga0193122_1059534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300018670|Ga0192819_1048760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300018671|Ga0193571_1018785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300018671|Ga0193571_1019892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300018674|Ga0193166_1025746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300018674|Ga0193166_1027324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300018681|Ga0193206_1033413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300018684|Ga0192983_1055640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300018692|Ga0192944_1053294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300018701|Ga0193405_1045154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300018703|Ga0193274_1031306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300018714|Ga0193349_1057474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300018714|Ga0193349_1062527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300018725|Ga0193517_1064645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300018725|Ga0193517_1069001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300018725|Ga0193517_1073304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300018730|Ga0192967_1042729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani759Open in IMG/M
3300018730|Ga0192967_1043621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani751Open in IMG/M
3300018735|Ga0193544_1027461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300018741|Ga0193534_1066553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300018742|Ga0193138_1032438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani686Open in IMG/M
3300018742|Ga0193138_1058542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300018745|Ga0193000_1040289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300018746|Ga0193468_1065542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300018749|Ga0193392_1056492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300018758|Ga0193058_1060922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani594Open in IMG/M
3300018758|Ga0193058_1070505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300018763|Ga0192827_1060618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani659Open in IMG/M
3300018763|Ga0192827_1080757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300018763|Ga0192827_1082397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300018765|Ga0193031_1043260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani738Open in IMG/M
3300018765|Ga0193031_1070511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300018765|Ga0193031_1078927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300018765|Ga0193031_1082531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300018765|Ga0193031_1083753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300018765|Ga0193031_1084004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300018765|Ga0193031_1084022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300018765|Ga0193031_1085671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300018765|Ga0193031_1091502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300018765|Ga0193031_1093662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300018766|Ga0193181_1036460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani713Open in IMG/M
3300018774|Ga0193570_1024426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani567Open in IMG/M
3300018776|Ga0193407_1070579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300018779|Ga0193149_1067382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300018782|Ga0192832_1059814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300018787|Ga0193124_1041949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani674Open in IMG/M
3300018796|Ga0193117_1070110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300018800|Ga0193306_1073158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300018801|Ga0192824_1106488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300018818|Ga0194242_10002282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300018823|Ga0193053_1074873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300018830|Ga0193191_1056887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani640Open in IMG/M
3300018831|Ga0192949_1070693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani689Open in IMG/M
3300018832|Ga0194240_1012774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani713Open in IMG/M
3300018832|Ga0194240_1012862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani712Open in IMG/M
3300018832|Ga0194240_1032558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300018836|Ga0192870_1091117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300018836|Ga0192870_1093959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300018838|Ga0193302_1057480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani655Open in IMG/M
3300018842|Ga0193219_1075998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300018846|Ga0193253_1093976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani706Open in IMG/M
3300018846|Ga0193253_1094999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300018846|Ga0193253_1138225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300018849|Ga0193005_1082304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300018853|Ga0192958_1138967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300018855|Ga0193475_1052997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani652Open in IMG/M
3300018855|Ga0193475_1060074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300018855|Ga0193475_1070644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300018855|Ga0193475_1079616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300018855|Ga0193475_1079903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300018860|Ga0193192_1058074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300018860|Ga0193192_1060585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300018862|Ga0193308_1083652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300018862|Ga0193308_1088254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300018871|Ga0192978_1066838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani666Open in IMG/M
3300018871|Ga0192978_1084684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300018871|Ga0192978_1105736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300018873|Ga0193553_1153250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300018874|Ga0192977_1074269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani688Open in IMG/M
3300018879|Ga0193027_1072856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani686Open in IMG/M
3300018880|Ga0193337_1044487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300018899|Ga0193090_1142033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300018913|Ga0192868_10069850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani565Open in IMG/M
3300018913|Ga0192868_10072164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300018913|Ga0192868_10079981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300018926|Ga0192989_10114662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300018926|Ga0192989_10119369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani655Open in IMG/M
3300018928|Ga0193260_10113434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300018928|Ga0193260_10133952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300018928|Ga0193260_10148028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300018932|Ga0192820_10141006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300018932|Ga0192820_10171050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300018934|Ga0193552_10209028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300018934|Ga0193552_10221197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300018934|Ga0193552_10225359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300018942|Ga0193426_10136838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300018942|Ga0193426_10158492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300018948|Ga0192985_1245432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300018968|Ga0192894_10335745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300018974|Ga0192873_10408559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300018974|Ga0192873_10408773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300018974|Ga0192873_10430438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300018975|Ga0193006_10227328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300018975|Ga0193006_10237840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300018975|Ga0193006_10255768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300018976|Ga0193254_10144469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300018977|Ga0193353_10175287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300018977|Ga0193353_10190954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300018977|Ga0193353_10216338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300018977|Ga0193353_10230105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300018977|Ga0193353_10232514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300018979|Ga0193540_10111915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300018979|Ga0193540_10201853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani547Open in IMG/M
3300018980|Ga0192961_10069416All Organisms → Viruses → Predicted Viral1042Open in IMG/M
3300018980|Ga0192961_10133241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani757Open in IMG/M
3300018980|Ga0192961_10171137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani658Open in IMG/M
3300018980|Ga0192961_10211863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300018980|Ga0192961_10220306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300018980|Ga0192961_10222155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300018980|Ga0192961_10236680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300018980|Ga0192961_10244268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300018980|Ga0192961_10247107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300018980|Ga0192961_10256161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300018981|Ga0192968_10109137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani734Open in IMG/M
3300018982|Ga0192947_10123848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani862Open in IMG/M
3300018982|Ga0192947_10133381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani829Open in IMG/M
3300018982|Ga0192947_10235060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300018982|Ga0192947_10238004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani588Open in IMG/M
3300018982|Ga0192947_10272662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300018986|Ga0193554_10334475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300018988|Ga0193275_10211374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani605Open in IMG/M
3300018989|Ga0193030_10153362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani746Open in IMG/M
3300018989|Ga0193030_10153363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani746Open in IMG/M
3300018989|Ga0193030_10153364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani746Open in IMG/M
3300018989|Ga0193030_10159964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani732Open in IMG/M
3300018989|Ga0193030_10160794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani730Open in IMG/M
3300018989|Ga0193030_10160795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani730Open in IMG/M
3300018989|Ga0193030_10163670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani724Open in IMG/M
3300018989|Ga0193030_10198794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani659Open in IMG/M
3300018989|Ga0193030_10255019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300018989|Ga0193030_10255773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300018989|Ga0193030_10261977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani565Open in IMG/M
3300018989|Ga0193030_10271484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300018989|Ga0193030_10279792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300018989|Ga0193030_10284689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300018989|Ga0193030_10300403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300018989|Ga0193030_10311611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300019001|Ga0193034_10134827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300019001|Ga0193034_10177893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300019001|Ga0193034_10187839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300019003|Ga0193033_10135960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani713Open in IMG/M
3300019010|Ga0193044_10246601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300019010|Ga0193044_10258085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300019010|Ga0193044_10263747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300019010|Ga0193044_10274190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300019010|Ga0193044_10281160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300019017|Ga0193569_10273022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani713Open in IMG/M
3300019021|Ga0192982_10315830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300019021|Ga0192982_10321974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300019021|Ga0192982_10367228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300019024|Ga0193535_10249211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300019025|Ga0193545_10139914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300019027|Ga0192909_10130378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani687Open in IMG/M
3300019027|Ga0192909_10228799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300019027|Ga0192909_10290547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300019031|Ga0193516_10216391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300019031|Ga0193516_10221483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300019031|Ga0193516_10247741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300019031|Ga0193516_10266469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300019031|Ga0193516_10268096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300019031|Ga0193516_10281071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300019031|Ga0193516_10286303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300019031|Ga0193516_10290794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300019031|Ga0193516_10292583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300019031|Ga0193516_10312676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300019032|Ga0192869_10264496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani746Open in IMG/M
3300019032|Ga0192869_10284962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani719Open in IMG/M
3300019032|Ga0192869_10334623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani661Open in IMG/M
3300019032|Ga0192869_10339192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani656Open in IMG/M
3300019032|Ga0192869_10363349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300019032|Ga0192869_10483251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300019032|Ga0192869_10489344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300019033|Ga0193037_10306313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300019033|Ga0193037_10316492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300019036|Ga0192945_10124335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani823Open in IMG/M
3300019036|Ga0192945_10140925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani774Open in IMG/M
3300019036|Ga0192945_10269952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300019036|Ga0192945_10270853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300019036|Ga0192945_10272406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300019036|Ga0192945_10273296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300019036|Ga0192945_10274902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300019036|Ga0192945_10277440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300019036|Ga0192945_10287831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300019037|Ga0192886_10309651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300019039|Ga0193123_10327784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300019039|Ga0193123_10415461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300019040|Ga0192857_10179443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300019045|Ga0193336_10537522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani567Open in IMG/M
3300019045|Ga0193336_10544328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300019045|Ga0193336_10551086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300019045|Ga0193336_10565161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300019045|Ga0193336_10582479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300019045|Ga0193336_10604751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300019045|Ga0193336_10605010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300019045|Ga0193336_10631869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300019048|Ga0192981_10202529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani774Open in IMG/M
3300019048|Ga0192981_10263367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani655Open in IMG/M
3300019048|Ga0192981_10301654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300019048|Ga0192981_10305201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300019048|Ga0192981_10306670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300019048|Ga0192981_10335147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300019049|Ga0193082_10397316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani746Open in IMG/M
3300019049|Ga0193082_10693726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300019050|Ga0192966_10046243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1334Open in IMG/M
3300019050|Ga0192966_10176316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani763Open in IMG/M
3300019050|Ga0192966_10297484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300019050|Ga0192966_10300234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani565Open in IMG/M
3300019050|Ga0192966_10320291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300019051|Ga0192826_10072239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1191Open in IMG/M
3300019051|Ga0192826_10287963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300019051|Ga0192826_10318827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300019051|Ga0192826_10326359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300019051|Ga0192826_10366698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300019095|Ga0188866_1019660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani708Open in IMG/M
3300019095|Ga0188866_1021235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300019095|Ga0188866_1021857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300019095|Ga0188866_1022378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300019095|Ga0188866_1027351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300019095|Ga0188866_1033847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300019097|Ga0193153_1031658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300019097|Ga0193153_1031997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300019097|Ga0193153_1033052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300019097|Ga0193153_1034021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300019103|Ga0192946_1051394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300019103|Ga0192946_1055099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300019103|Ga0192946_1064067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300019116|Ga0193243_1049644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300019116|Ga0193243_1051306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani571Open in IMG/M
3300019116|Ga0193243_1060669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300019117|Ga0193054_1074944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300019118|Ga0193157_1028330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300019118|Ga0193157_1030401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300019118|Ga0193157_1030539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300019118|Ga0193157_1033651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300019118|Ga0193157_1033811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300019118|Ga0193157_1034350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300019118|Ga0193157_1035704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300019118|Ga0193157_1037529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300019118|Ga0193157_1038469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300019120|Ga0193256_1078814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300019123|Ga0192980_1074902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300019123|Ga0192980_1077520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300019123|Ga0192980_1081869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300019123|Ga0192980_1083957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300019125|Ga0193104_1056984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300019129|Ga0193436_1063496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300019133|Ga0193089_1139651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300019146|Ga0188881_10036877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani607Open in IMG/M
3300019149|Ga0188870_10115463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300019149|Ga0188870_10141346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300019150|Ga0194244_10054632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani666Open in IMG/M
3300019150|Ga0194244_10083033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani582Open in IMG/M
3300019253|Ga0182064_1180008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300019272|Ga0182059_1752955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300019274|Ga0182073_1303374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300019282|Ga0182075_1273050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300019282|Ga0182075_1320995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani617Open in IMG/M
3300019459|Ga0181562_10329483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani752Open in IMG/M
3300020052|Ga0181554_1289939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani619Open in IMG/M
3300020074|Ga0194113_10462699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani918Open in IMG/M
3300020074|Ga0194113_10580352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani793Open in IMG/M
3300020074|Ga0194113_11115059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300020141|Ga0211732_1442491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300020159|Ga0211734_10596650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1290Open in IMG/M
3300020165|Ga0206125_10158845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani904Open in IMG/M
3300020166|Ga0206128_1182203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani819Open in IMG/M
3300020172|Ga0211729_10734801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300020175|Ga0206124_10241900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300020175|Ga0206124_10365320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300020179|Ga0194134_10311958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani615Open in IMG/M
3300020182|Ga0206129_10215321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani836Open in IMG/M
3300020220|Ga0194119_10628630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300020382|Ga0211686_10349230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani603Open in IMG/M
3300020436|Ga0211708_10416959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300020503|Ga0208363_1032420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani591Open in IMG/M
3300020505|Ga0208088_1022625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300020525|Ga0207938_1036234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani745Open in IMG/M
3300020573|Ga0208485_1056336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani688Open in IMG/M
3300020575|Ga0208053_1073427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300020595|Ga0206126_10326665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani687Open in IMG/M
3300020732|Ga0214201_1027861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani950Open in IMG/M
3300021085|Ga0206677_10182909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani910Open in IMG/M
3300021092|Ga0194122_10294584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani834Open in IMG/M
3300021092|Ga0194122_10480411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani621Open in IMG/M
3300021108|Ga0214162_1050671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300021169|Ga0206687_1594294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300021169|Ga0206687_1731801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300021169|Ga0206687_1800871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani723Open in IMG/M
3300021334|Ga0206696_1513694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300021342|Ga0206691_1153785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300021342|Ga0206691_1317593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300021342|Ga0206691_1379085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani619Open in IMG/M
3300021342|Ga0206691_1431271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300021342|Ga0206691_1516746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300021342|Ga0206691_1682952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300021342|Ga0206691_1694311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300021342|Ga0206691_1771760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300021345|Ga0206688_10243725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300021345|Ga0206688_10336057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300021345|Ga0206688_10708140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300021345|Ga0206688_10808378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300021348|Ga0206695_1015529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300021348|Ga0206695_1334361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300021348|Ga0206695_1413547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300021348|Ga0206695_1490446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300021348|Ga0206695_1500682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani687Open in IMG/M
3300021348|Ga0206695_1551554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300021348|Ga0206695_1783085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300021350|Ga0206692_1272783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300021350|Ga0206692_1470707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300021353|Ga0206693_1334528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300021353|Ga0206693_1460778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300021353|Ga0206693_1656705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300021355|Ga0206690_10192398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300021355|Ga0206690_10255797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300021355|Ga0206690_10346253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300021359|Ga0206689_10901818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300021359|Ga0206689_11041740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300021359|Ga0206689_11042433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300021359|Ga0206689_11113279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300021365|Ga0206123_10192444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani911Open in IMG/M
3300021365|Ga0206123_10264164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani743Open in IMG/M
3300021368|Ga0213860_10188726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani908Open in IMG/M
3300021376|Ga0194130_10458060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani662Open in IMG/M
3300021869|Ga0063107_104383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300021889|Ga0063089_1004839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300021892|Ga0063137_1000141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300021896|Ga0063136_1000038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300021902|Ga0063086_1008605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300021925|Ga0063096_1001596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300021925|Ga0063096_1019601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300021927|Ga0063103_1005485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300021928|Ga0063134_1022174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300021941|Ga0063102_1049390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300021950|Ga0063101_1027871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300021957|Ga0222717_10295879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani925Open in IMG/M
3300021957|Ga0222717_10332989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani857Open in IMG/M
3300021958|Ga0222718_10402373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani684Open in IMG/M
3300021960|Ga0222715_10570032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300021960|Ga0222715_10690112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300021962|Ga0222713_10179018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1436Open in IMG/M
3300021962|Ga0222713_10468253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300021963|Ga0222712_10332402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani942Open in IMG/M
3300021964|Ga0222719_10802907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300022752|Ga0214917_10208669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani954Open in IMG/M
3300022827|Ga0222647_1063109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300022829|Ga0222706_1026240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300022905|Ga0255756_1173566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani817Open in IMG/M
3300022929|Ga0255752_10269040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani743Open in IMG/M
(restricted) 3300023085|Ga0233406_10068856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300023174|Ga0214921_10339496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani807Open in IMG/M
3300023179|Ga0214923_10358552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani765Open in IMG/M
3300023179|Ga0214923_10438449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani658Open in IMG/M
3300023566|Ga0228679_1020584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani680Open in IMG/M
3300023685|Ga0228686_1030537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300023696|Ga0228687_1031320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
(restricted) 3300024261|Ga0233439_10259573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani763Open in IMG/M
3300024322|Ga0228656_1076682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani727Open in IMG/M
3300024343|Ga0244777_10427834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani821Open in IMG/M
3300024343|Ga0244777_10463356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani782Open in IMG/M
3300025138|Ga0209634_1177818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani837Open in IMG/M
3300025328|Ga0208384_109821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300025340|Ga0208866_1004692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani843Open in IMG/M
3300025367|Ga0208108_1014118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani911Open in IMG/M
3300025369|Ga0208382_1041815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300025387|Ga0207959_1026099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani948Open in IMG/M
3300025532|Ga0208249_1125531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300025570|Ga0208660_1042148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1182Open in IMG/M
3300025570|Ga0208660_1068393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani838Open in IMG/M
3300025570|Ga0208660_1089354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300025578|Ga0208864_1126455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300025626|Ga0209716_1112341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani757Open in IMG/M
3300025680|Ga0209306_1103295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani845Open in IMG/M
3300025685|Ga0209095_1127319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani767Open in IMG/M
3300025699|Ga0209715_1193144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani644Open in IMG/M
3300025704|Ga0209602_1134852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani815Open in IMG/M
3300025712|Ga0209305_1139934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani744Open in IMG/M
3300025732|Ga0208784_1043234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1402Open in IMG/M
3300025732|Ga0208784_1138874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani720Open in IMG/M
3300025849|Ga0209603_1301796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300025869|Ga0209308_10092505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1480Open in IMG/M
3300025869|Ga0209308_10257780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani745Open in IMG/M
3300025874|Ga0209533_1229914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani758Open in IMG/M
3300025879|Ga0209555_10195980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani816Open in IMG/M
3300025880|Ga0209534_10207448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani974Open in IMG/M
3300025887|Ga0208544_10090920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1392Open in IMG/M
3300025887|Ga0208544_10272555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300025890|Ga0209631_10122422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1452Open in IMG/M
3300025892|Ga0209630_10491266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300025894|Ga0209335_10231699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani825Open in IMG/M
3300026130|Ga0209961_1057148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani741Open in IMG/M
3300026136|Ga0208763_1030444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300026136|Ga0208763_1042449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300026166|Ga0208276_1035447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300026182|Ga0208275_1014318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1717Open in IMG/M
3300026182|Ga0208275_1069697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani685Open in IMG/M
3300026182|Ga0208275_1108823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300026189|Ga0208405_1027842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani877Open in IMG/M
3300026272|Ga0209913_1083057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani692Open in IMG/M
3300026420|Ga0247581_1084560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300026443|Ga0247559_1131236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300026448|Ga0247594_1043011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani772Open in IMG/M
3300026449|Ga0247593_1107364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300026449|Ga0247593_1123153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300026461|Ga0247600_1080900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300026465|Ga0247588_1069757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani696Open in IMG/M
3300026465|Ga0247588_1109223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300026465|Ga0247588_1120870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300026466|Ga0247598_1131175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300026468|Ga0247603_1132750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300026470|Ga0247599_1076517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300026491|Ga0228641_1105881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300026495|Ga0247571_1129042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300026500|Ga0247592_1131099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300026503|Ga0247605_1136469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani591Open in IMG/M
3300026503|Ga0247605_1157686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300026503|Ga0247605_1169587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300026513|Ga0247590_1160042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300026513|Ga0247590_1189692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300027189|Ga0208675_1019829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani825Open in IMG/M
3300027191|Ga0208021_1057931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300027217|Ga0208928_1056997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300027237|Ga0208930_1048621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300027308|Ga0208796_1059201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani843Open in IMG/M
3300027320|Ga0208923_1046043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani777Open in IMG/M
3300027366|Ga0208556_1096855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300027571|Ga0208897_1110727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300027586|Ga0208966_1082889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani890Open in IMG/M
3300027708|Ga0209188_1184620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani762Open in IMG/M
3300027708|Ga0209188_1187079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300027708|Ga0209188_1205064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300027753|Ga0208305_10241246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani643Open in IMG/M
3300027759|Ga0209296_1234327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani765Open in IMG/M
3300027770|Ga0209086_10336029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300027801|Ga0209091_10236617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani893Open in IMG/M
3300027805|Ga0209229_10354677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani641Open in IMG/M
3300027810|Ga0209302_10194438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani974Open in IMG/M
3300027810|Ga0209302_10202446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani950Open in IMG/M
3300027810|Ga0209302_10411264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300027810|Ga0209302_10435062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani588Open in IMG/M
3300027833|Ga0209092_10086257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1881Open in IMG/M
3300027833|Ga0209092_10274017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani921Open in IMG/M
3300027833|Ga0209092_10378513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani746Open in IMG/M
3300027833|Ga0209092_10382136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani742Open in IMG/M
3300027833|Ga0209092_10453422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani663Open in IMG/M
3300027836|Ga0209230_10812518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300027849|Ga0209712_10419441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani753Open in IMG/M
3300027849|Ga0209712_10446821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani726Open in IMG/M
3300027883|Ga0209713_10500086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani793Open in IMG/M
3300027883|Ga0209713_10564566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300027899|Ga0209668_10427249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani870Open in IMG/M
3300027899|Ga0209668_10563175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300027899|Ga0209668_10790219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300027902|Ga0209048_11089529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300027969|Ga0209191_1195249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani800Open in IMG/M
3300027974|Ga0209299_1170496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani811Open in IMG/M
3300027983|Ga0209284_10114872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1426Open in IMG/M
(restricted) 3300027997|Ga0255057_10235040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani889Open in IMG/M
3300028102|Ga0247586_1062375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300028106|Ga0247596_1110013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300028109|Ga0247582_1202467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300028110|Ga0247584_1111931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300028110|Ga0247584_1155942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300028110|Ga0247584_1163389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300028137|Ga0256412_1255373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani646Open in IMG/M
3300028137|Ga0256412_1315831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300028137|Ga0256412_1326122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300028137|Ga0256412_1331152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300028137|Ga0256412_1401107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300028233|Ga0256417_1224134All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani502Open in IMG/M
3300028279|Ga0228613_1108370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300028282|Ga0256413_1225237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300028282|Ga0256413_1261731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300028282|Ga0256413_1367189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300028290|Ga0247572_1193042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300028290|Ga0247572_1202331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300028335|Ga0247566_1069599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300028335|Ga0247566_1095169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300028335|Ga0247566_1097567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300028337|Ga0247579_1121294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300028393|Ga0304728_1222423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani645Open in IMG/M
3300028412|Ga0306910_1034410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani809Open in IMG/M
3300028575|Ga0304731_11014137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300028575|Ga0304731_11014137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300028575|Ga0304731_11537823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300028595|Ga0272440_1165274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300030671|Ga0307403_10583429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani606Open in IMG/M
3300030671|Ga0307403_10832637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300030699|Ga0307398_10131072All Organisms → Viruses → Predicted Viral1272Open in IMG/M
3300030699|Ga0307398_10807040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300030699|Ga0307398_10843965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300030702|Ga0307399_10547528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300030715|Ga0308127_1049892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300030720|Ga0308139_1079885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300030723|Ga0308129_1024923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani649Open in IMG/M
3300030780|Ga0073988_12287416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani620Open in IMG/M
3300030857|Ga0073981_10008585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300031004|Ga0073984_11288918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani616Open in IMG/M
3300031032|Ga0073980_10006615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300031036|Ga0073978_1022779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani624Open in IMG/M
3300031038|Ga0073986_11786632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300031062|Ga0073989_10013708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300031062|Ga0073989_13475399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300031216|Ga0307980_1060205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani809Open in IMG/M
3300031382|Ga0307971_1153993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani660Open in IMG/M
3300031522|Ga0307388_11265867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300031557|Ga0308148_1040238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300031569|Ga0307489_10143661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1427Open in IMG/M
3300031569|Ga0307489_10156407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1376Open in IMG/M
3300031569|Ga0307489_10441760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani874Open in IMG/M
3300031579|Ga0308134_1098111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300031579|Ga0308134_1135709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani565Open in IMG/M
3300031579|Ga0308134_1164828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300031579|Ga0308134_1166377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300031580|Ga0308132_1115524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300031589|Ga0307996_1118711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani700Open in IMG/M
3300031594|Ga0302131_1137806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani828Open in IMG/M
3300031621|Ga0302114_10326201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani594Open in IMG/M
3300031621|Ga0302114_10328167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani591Open in IMG/M
3300031621|Ga0302114_10342971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300031621|Ga0302114_10371472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300031622|Ga0302126_10191663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani734Open in IMG/M
3300031626|Ga0302121_10070597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1055Open in IMG/M
3300031626|Ga0302121_10142144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani690Open in IMG/M
3300031709|Ga0307385_10418114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300031710|Ga0307386_10754272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300031725|Ga0307381_10205592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani689Open in IMG/M
3300031725|Ga0307381_10409524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300031729|Ga0307391_10885650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300031734|Ga0307397_10461819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300031735|Ga0307394_10473820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300031735|Ga0307394_10474100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300031739|Ga0307383_10474934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani621Open in IMG/M
3300031739|Ga0307383_10541300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300031739|Ga0307383_10713952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300031739|Ga0307383_10734153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300031742|Ga0307395_10382472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300031784|Ga0315899_10720450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani924Open in IMG/M
3300032047|Ga0315330_10383089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani870Open in IMG/M
3300032127|Ga0315305_1151053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani615Open in IMG/M
3300032150|Ga0314779_1034259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300032256|Ga0315271_10900085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani763Open in IMG/M
3300032462|Ga0335396_10268729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1114Open in IMG/M
3300032519|Ga0314676_10150130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1258Open in IMG/M
3300032519|Ga0314676_10734015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani574Open in IMG/M
3300032521|Ga0314680_10700120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300032522|Ga0314677_10482427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani661Open in IMG/M
3300032540|Ga0314682_10744682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300032615|Ga0314674_10659478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300032616|Ga0314671_10317704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani849Open in IMG/M
3300032616|Ga0314671_10571701All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris612Open in IMG/M
3300032616|Ga0314671_10627896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300032650|Ga0314673_10685010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300032707|Ga0314687_10480089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani692Open in IMG/M
3300032708|Ga0314669_10463516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani697Open in IMG/M
3300032724|Ga0314695_1370712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300032727|Ga0314693_10423657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani726Open in IMG/M
3300032733|Ga0314714_10437151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300032734|Ga0314706_10622894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300032747|Ga0314712_10603285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300032749|Ga0314691_10433805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300032752|Ga0314700_10644823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300032755|Ga0314709_10464790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani777Open in IMG/M
3300032820|Ga0310342_101213264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani892Open in IMG/M
3300032820|Ga0310342_101267782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani873Open in IMG/M
3300032820|Ga0310342_102748898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani588Open in IMG/M
3300033572|Ga0307390_11042981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300033572|Ga0307390_11044041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300033984|Ga0334989_0631270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300034060|Ga0334983_0586278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine32.88%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine13.69%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.27%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.27%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.38%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.15%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.25%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.81%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.58%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.23%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.23%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.23%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.91%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.91%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.91%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.46%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.01%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.90%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.90%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.90%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.67%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.67%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.56%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.56%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.56%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.45%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.45%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.45%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.34%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.34%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.34%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.34%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.34%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.34%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.34%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.34%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.22%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.22%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.22%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.22%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.22%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.22%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.22%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.22%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.11%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.11%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.11%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.11%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine0.11%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.11%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.11%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.11%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.11%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.11%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.11%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.11%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2236876011Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-3LG-Hyp-75mEnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000736Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011EnvironmentalOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001848Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3aEnvironmentalOpen in IMG/M
3300002349Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003555Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_17_M020 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003677Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_66_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003681Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_48_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_150m_A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003787Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09EnvironmentalOpen in IMG/M
3300003798Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07EnvironmentalOpen in IMG/M
3300003802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07EnvironmentalOpen in IMG/M
3300003821Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE22May08EnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004507Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004685Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004689Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE20Aug07 (version 2)EnvironmentalOpen in IMG/M
3300004690Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Jul07 (version 2)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004784Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004786Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300005599Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91AEnvironmentalOpen in IMG/M
3300005608Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84AEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005980Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203EnvironmentalOpen in IMG/M
3300006071Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09EnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006728Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2967 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007523Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007629Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3EnvironmentalOpen in IMG/M
3300007655Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300008995Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009195Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4CEnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009728Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_213_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010158Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012036Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012705Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES047 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012709Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012715Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012716Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012771Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013115Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016697Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES156 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016726Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016729Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101402AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016739Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016741Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016746Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016749Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016758Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071403BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016882Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with 33 psu seawater, 19 C, 33 psu salinity and 331 ?mol photons light - Strombidium rassoulzadegani ras09 (MMETSP0449_2)Host-AssociatedOpen in IMG/M
3300017280Metatranscriptome of coastal eukaryotic communities from Ligurian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 638 ?mol photons light - Strombidium inclinatum S3 (MMETSP0208)Host-AssociatedOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018039Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018567Metatranscriptome of marine microbial communities from Baltic Sea - GS683_3p0_dTEnvironmentalOpen in IMG/M
3300018575Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782379-ERR1712162)EnvironmentalOpen in IMG/M
3300018596Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002183 (ERX1782364-ERR1711927)EnvironmentalOpen in IMG/M
3300018602Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782193-ERR1711945)EnvironmentalOpen in IMG/M
3300018603Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782239-ERR1711906)EnvironmentalOpen in IMG/M
3300018605Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001754 (ERX1782444-ERR1712177)EnvironmentalOpen in IMG/M
3300018609Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782449-ERR1712128)EnvironmentalOpen in IMG/M
3300018617Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000604 (ERX1782236-ERR1711896)EnvironmentalOpen in IMG/M
3300018618Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000071 (ERX1782354-ERR1712005)EnvironmentalOpen in IMG/M
3300018625Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000598 (ERX1782204-ERR1712199)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018653Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003013 (ERX1789553-ERR1719190)EnvironmentalOpen in IMG/M
3300018655Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000522 (ERX1782387-ERR1711943)EnvironmentalOpen in IMG/M
3300018658Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000674 (ERX1789517-ERR1719451)EnvironmentalOpen in IMG/M
3300018661Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782311-ERR1712063)EnvironmentalOpen in IMG/M
3300018670Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782175-ERR1712065)EnvironmentalOpen in IMG/M
3300018671Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018681Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000072 (ERX1782177-ERR1712164)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018701Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789579-ERR1719459)EnvironmentalOpen in IMG/M
3300018703Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782405-ERR1712108)EnvironmentalOpen in IMG/M
3300018714Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001812 (ERX1782478-ERR1711985)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018735Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399747-ERR1328127)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018746Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002179 (ERX1789625-ERR1719155)EnvironmentalOpen in IMG/M
3300018749Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789662-ERR1719448)EnvironmentalOpen in IMG/M
3300018758Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782363-ERR1712059)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018774Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513EnvironmentalOpen in IMG/M
3300018776Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789638-ERR1719404)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018801Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000063 (ERX1789476-ERR1719434)EnvironmentalOpen in IMG/M
3300018818Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1086442-ERR1007415)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018830Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000006 (ERX1789678-ERR1719267)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018849Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002287 (ERX1789411-ERR1719439)EnvironmentalOpen in IMG/M
3300018853Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782437-ERR1712106)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018860Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000007 (ERX1782399-ERR1711861)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018879Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002480 (ERX1789365-ERR1719178)EnvironmentalOpen in IMG/M
3300018880Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782455-ERR1712124)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018932Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782293-ERR1711916)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018948Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809757-ERR1740124)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019085Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dTEnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019120Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789686-ERR1719360)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019146Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019253Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020052Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011503CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300020503Freshwater microbial communities from Lake Mendota, WI - 03MAY2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020505Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020525Freshwater microbial communities from Lake Mendota, WI - 05MAR2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020573Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020575Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300020732Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 epilimnionEnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021092Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10mEnvironmentalOpen in IMG/M
3300021108Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021869Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021892Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S15 C1 B20 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300022827Saline water microbial communities from Ace Lake, Antarctica - #333EnvironmentalOpen in IMG/M
3300022829Saline water microbial communities from Ace Lake, Antarctica - #1572EnvironmentalOpen in IMG/M
3300022905Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaGEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300023085 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_5_MGEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300023566Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024261 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MGEnvironmentalOpen in IMG/M
3300024322Seawater microbial communities from Monterey Bay, California, United States - 68DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025328Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025340Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE20Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025367Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE22May08 (SPAdes)EnvironmentalOpen in IMG/M
3300025369Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025387Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025532Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025578Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025685Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025874Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300026130Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026136Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes)EnvironmentalOpen in IMG/M
3300026166Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91A (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026189Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A (SPAdes)EnvironmentalOpen in IMG/M
3300026272Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 (SPAdes)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026491Seawater microbial communities from Monterey Bay, California, United States - 52DEnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027189Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579 (SPAdes)EnvironmentalOpen in IMG/M
3300027191Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes)EnvironmentalOpen in IMG/M
3300027217Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027237Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300027366Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027836Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027983Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes)EnvironmentalOpen in IMG/M
3300027997 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028279Seawater microbial communities from Monterey Bay, California, United States - 14DEnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028337Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 38R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028393Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028412Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698 (v2)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030723Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031216Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1060EnvironmentalOpen in IMG/M
3300031382Saline water microbial communities from Organic Lake, Antarctica - #714EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031557Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031594Marine microbial communities from Western Arctic Ocean, Canada - CB9_20mEnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032127Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_Tmax_529 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032150Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032462Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032749Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
none_10164722236876011Marine EstuarineMKFTIIALVATVSAGLPPSAGLGHPIIPATREDFDNAKGVWKGDWASYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTHFQTKLQASLLTADRKSSVIV
DelMOSpr2010_1020890313300000116MarinePPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
DelMOWin2010_1013805523300000117MarineMKFILALIATAAAGPAPAVGLGHGIIPSTREDFDNAQGVWKGNWAGYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC*
DelMOWin2010_1015975213300000117MarineVALAGTPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF*
SA_S1_NOR08_45mDRAFT_1011539823300000128MarineHPHNIEAVQISGTPPKVGLGHAVIPANREXFXNAXGVWGGDFAKYRAAHPHDQDCSISESDNFKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADC*
SA_S2_NOR15_50mDRAFT_1006262833300000130MarineMKFTSIVALIATVEARHHEYVALDARPPTIGLAHANIPATIETYDNGKELWKANWASYRKARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSQDH*
SA_S2_NOR15_50mDRAFT_1011502623300000130MarineMKSFAIAMLVAVVSAGAPPTVGLGHAIIPQTREEYDNSKDLWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADH*
JGI12547J11936_105583623300000736Freshwater And SedimentMKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNASSLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
JGI20155J14468_1006663623300001354Pelagic MarineKLLLIIINNIMKFPALAALLATASAGAPPTVGLGHQYVPATREDYDNSKELWKGDWAKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARVCERGGWCSGYDGCEGTPLPDQAPGLAADH*
JGI20155J14468_1010250233300001354Pelagic MarineMKFTAIAALVATVSAGSPPAVGLGHAVIPATREDYDNAKELWKGDWAKYRAAHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH*
JGI20155J14468_1013345813300001354Pelagic MarineMKFFALAALLAIAEAGTPPTVGLGHGVVPATREDYDNAKDLWKGSWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADC*
JGI20155J14468_1013621413300001354Pelagic MarineMKFSAIAALFAATVSAGSPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF*
JGI20155J14468_1015527913300001354Pelagic MarineTIIAALVAVAQAGSPPAVGLGHAVIPATREDYDNAKELWKGDWAKYRAAHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH*
JGI20158J14315_1012318523300001355Pelagic MarineMKFAVAALVAIAQAGLPPSAGLGHPIIPATREDFDNAKGVWKGDWASYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
RCM47_108508213300001848Marine PlanktonFAAVEAGTPPTVGLGHAYIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
B570J29580_10546213300002349FreshwaterNYNFKMKFTAIAALLAATVSAGKPPSVGLGHAYIPATREDYDNAASLWKNDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
B570J40625_10083336113300002835FreshwaterMKFTAIAALLAATVSAGKPPSVGLGHAYIPATREDYDNAASLWKNDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
B570J40625_10101622713300002835FreshwaterMKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
JGI26079J46598_104752913300003216MarineMKSFVLAAIAAVVSAGAPPTVGLGHAVIPQTREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0008453J51685_10537013300003555SeawaterMKFILATIVAAVSAGAPPAVGLGHGIIPATREDFDNSKGVWGGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0008458J53046_10104713300003677SeawaterLLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0008457_100897413300003681SeawaterIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0008459J53047_100181513300003683SeawaterFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0008459J53047_104030213300003683SeawaterIIMKFTAIAALVATVSAGSPPAVGLGHAVIPATREDYDNAKELWKGDWAKYRAAHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH*
Ga0005233J53080_102236513300003701MarineVLAALIAAVSAGTPPTVGLGHGFVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0007811_102049113300003787FreshwaterSKHNKMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0007842_101261213300003798FreshwaterMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0007840_100991313300003802FreshwaterIVNLFFINKYYSKHNKMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0007843_10649713300003821FreshwaterKYYSKHNKMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0031658_103216713300003860Freshwater Lake SedimentMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNASSLWKSNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0031658_104473313300003860Freshwater Lake SedimentMKFTAIAALLAATVSAGKPPSVGLGHAYIPATREDYDNAATLWKNDWAKYRAAHPNDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0055584_10098609913300004097Pelagic MarineMKIFAIASLFAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0055584_10200966013300004097Pelagic MarineMKYFALAALIAAASAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0008280_101396013300004507MarineSFVLAAIAAVVSAGAPPTVGLGHAVVPQTREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0065177_108451713300004685FreshwaterKMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0065172_100393213300004689FreshwaterNLFFINKYYSKHNKMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0065175_101630213300004690FreshwaterNKYYSKHNKMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0007748_1009013013300004769Freshwater LakeKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNASSLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0007744_132674013300004784Freshwater LakeKIMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNASSLWKSNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0007753_147639313300004786Freshwater LakeAIAALLAATVSAGNPPSVGLGHAHIPATREDYDNAASLWKNDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0007752_1016815233300004789Freshwater LakeVKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNASSLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0007758_1000510013300004790Freshwater LakeAVEAGTPPTVGLGHAFIPANREDYDNAASLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0066830_1004275123300005433MarineMKYFAIAALLGVAAAGTPPAVGLGHAYVPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0066830_1006099333300005433MarineMKFAVAALIATVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0066830_1015225313300005433MarineMKYFALAALLAAVNAGTPPAVGLGHAYIPANREDYDNAQALWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0066831_1005357523300005516MarineMKLIALTALIATVSAGAPPAVGLGHAFIPATREDFDNAKGLWKGDWAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH*
Ga0049082_1020372713300005584Freshwater LenticYNYNFKMKFTAIAALLAATVSAGKPPSVGLGHAYIPATREDYDNAAALWKNDWAKYRAAHPNDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0049082_1021775613300005584Freshwater LenticKSFALVALFAAVVSAGKPPQVGLGHAYVPATRETYDNAAELWKNNWAKYRAAHPNDQDCAVKESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0049084_1030681613300005585Freshwater LenticMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNASSLWKSNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*SAKL*F*KSSKQVHLKGMNKPGPVIVALINT
Ga0066841_1007903913300005599MarineHITMKFFALAALIATASAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0066840_1008633923300005608MarineMKFVIAALLGAVSAGSPPAVGLGHAYIPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0066840_1008872813300005608MarineMKFFAIAALFAAEASAGTPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF*ESYGAPLAQTVIL*YI*
Ga0078894_1082286613300005662Freshwater LakeMKSFALVALFAAVVSAGKPPHVGLGHAYVPATRETYDNAAELWKNNWAKYRAAHPNDQDCSVRESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0066798_1013658813300005980SoilMKLYALIALFAAVEAGTPPTVGLGHAFVPANREDYDNAASLWKGSWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*SAKL**
Ga0007876_107215013300006071FreshwaterMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*SAKL*F*KSSEPVYLKGRKKIRSVIVALINTLKYLS*
Ga0075501_133792513300006355AqueousLIMKFTILALVAVVSAKHNHEFVGLSAMPPTTGLSAKNIPKTREDYDNGVTLWGGDYKKYRASRPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0075502_166689613300006357AqueousMKTIAIAALFAAVSARRPQNYQNLAIDAAPPTVGLGHEVVPVTREDYDNGKELWKNNWANYRKARPNEQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSVDN*
Ga0075512_127711313300006374AqueousIIMKTIAIAALFAAVSARRPQNYQNLAIDAAPPTVGLGHEVVPVTREDYDNGKELWKNNWANYRKARPNEQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSVDN*
Ga0075509_152611413300006390AqueousIMKTIAIAALFAAVSARRPQNYQNLAIDAAPPTVGLGHEVVPVTREDYDNGKELWKNNWANYRKARPNEQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSVDN*
Ga0075493_157669013300006396AqueousHHHNGLVQMHDSYDPAVVPAAGPSPPAVGLGHETIPWNREVYDNAKELWAGDWAKYRSAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSQDH
Ga0075488_103415713300006397AqueousLTIMKFILALIATAAAGPAPAVGLGHGIIPSTREDFDNAQGVWKGNWAGYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC*
Ga0075495_160421823300006399AqueousIMKFAVAALIATVSAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0075506_172116113300006401AqueousKTIAIAALFAAVSARRPQNYQNLAIDAAPPTVGLGHEVVPVTREDYDNGKELWKNNWANYRKARPNEQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSVDN*
Ga0075514_100143313300006403AqueousLLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0075515_1000965413300006404AqueousFIIMKFIAIAALFATVDALAPPTVGLGHAIIPSNREDYDNGKELWKSNWANYRKARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSVDN*
Ga0075471_1012025633300006641AqueousMKIAFLLAVVSARHHELVELAPPTQGLTSPTIPKTREDYDNGQALWGGDYRKYRASRPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0075471_1037184813300006641AqueousMKYTIIAAIVAATSALEPPTVGLGHPNIPLNREDYDNGKELWGSNWAKYRAARPNDQDCGISESDNWKGAQQCSQNWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSVDN*
Ga0031676_100562613300006728Deep OceanIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0075467_1014303433300006803AqueousMHDSYDPAVVPAAGPSPPAVGLGHETIPWNREVYDNAKELWAGDWAKYRSAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSQDH*
Ga0075467_1039617023300006803AqueousMKFAVIALVAIAQAGTPPSSGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0075467_1044624713300006803AqueousMKFTSFAALVAVVAAAAPPTVGLGHNVIPANREDYDNGAALWKNDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSMDH*
Ga0075473_1008802523300006875AqueousELPPPTKGLWASNIYKTREDYDNGATLWGGDYKKYRASRPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0075469_1010130023300007231AqueousMKFAIAAIIATVSAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0105019_120493723300007513MarineMKYFAIAALFAAANAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0105019_124226413300007513MarineMKFFAALAIGLVSAGSPPSVGLGHALIPANREDFDNAKDLWKNDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH*
Ga0105019_124600613300007513MarineMKYFTFAALLATVSAGSPPSVGLGHALIPANREDFDNAKDLWKNDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH*
Ga0105052_1103443513300007523FreshwaterMKFITFVAIIASVSAKHHYNTEFVDISAAPPTVGLGHSKIPSNREDYDNGAALWKNNWASYRAARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSADH*
Ga0102818_105529513300007552EstuarineMKFLAIAALFAAVEARPHNYENLEIEAKPPTVGLGHAIIPENREDYDNGATLWKNDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDC*
Ga0102818_106528913300007552EstuarineMKFSTITALVATVAARHHNHELVEVSAAPPTVGLGHSVIPTNREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDSWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0102818_109294213300007552EstuarineMKFIAVAALFAAVDAATPPTVGLGHSIVPETREDYDNGATLWKKDWAGYRGAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDC*
Ga0102822_110982513300007558EstuarineMKYIALLAAVVSAGTPPAAGLGHPIIPATREDFDNAKGVWKGDWAAYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0102822_115441813300007558EstuarinePTVGLGHAYIPANREDFDNGKELWKGDWKKYRASRPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDC*
Ga0102948_117316213300007623WaterMKFIAIAALFACVEAAAPPTVGLGHSVIPANREDYDNGAELWKNDWAAYRRARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDN*
Ga0102895_118563813300007629EstuarinePVGLGHAYIPANREDFDNGKELWKGDWKKYRASRPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDC*
Ga0102825_107020813300007655EstuarineMKFLAIAALFAAVEARPHNYENLEIEAKPPTVGLGHAIIPENREDYDNGATLWKNDWAKYRAAHPNDQDCSISESDNWKGAQQYSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDC*
Ga0102910_113355113300007667EstuarineESDGKKGKKYNPPSVGLGHKWIPATREDYNNAKDLWKGDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDC*
Ga0102827_109414613300007715EstuarineVINKFYNYIINTKMKFTILALVATVAAGTPPSAGLGHPIIPATREDFDNAKGVWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0102852_104515523300007718EstuarineMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0102951_112042113300007725WaterMRSLKIFIVDDSFQLLIIIYNPIIMKYFAFAALIAAAQAGTPPTVGLGHQYIPATREDYDNAQSLWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADC*
Ga0105737_109833813300007862Estuary WaterPTVGLGHSIVPETREDYDNGATLWKKDWAGYRGAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDC*
Ga0105744_105846513300007863Estuary WaterPKTPKPRYNEINQWRMDSAEHCLKFVSIISIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0105744_106241013300007863Estuary WaterMKIIAIASLFAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0102904_112530813300007981EstuarineMKFAVAALIATVSAGLPPSAGLGHPIIPATREDFDNAKGVWTGDWAKYRSAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0114343_118276313300008110Freshwater, PlanktonLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0114336_136064313300008261Freshwater, PlanktonIMKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0103951_1071338413300008832MarineILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWAGNWGDYRKARPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0103951_1081846713300008832MarineMKFTAFVALFAAVEARNHEYVALDAAPPTIGLAHGVIPSTREDYDNGKELWKANWANYRKARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSLDH*
Ga0103732_106202213300008929Ice Edge, Mcmurdo Sound, AntarcticaMKFILVALVATAAAAAPPAVGLGHGIIPATREDFDNSKGVWKGDWAKYRAGHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0103734_103877013300008931Ice Edge, Mcmurdo Sound, AntarcticaMLGGPYVPPPSVGLGHEVIPATREDFDNSKGIWKGDWAAYKKAHPHDQDCSIAESDSWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0103738_101965023300008935Ice Edge, Mcmurdo Sound, AntarcticaMKFTAIAALVATVSAGSPPAVGLGHAIIPATREEHDNAASLWKGDWAKYRASHPADQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLLPDH*
Ga0104258_106942413300008993Ocean WaterKFFAIAALFAATASAGTPPTVGLGHAYVPSTREDYDNAKELWKGDWSKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF*
Ga0104258_110983613300008993Ocean WaterLKMKFFALAALLAIAEAGTPPTVGLGHGVVPATREDYDNAKDLWKGSWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADC*
Ga0104258_111098713300008993Ocean WaterAAVAAQPSVGLASAYIPATREDYANSDELWGGNWGDYRKARPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH*
Ga0104258_111522213300008993Ocean WaterFAIAALFAAVNAGTPPTVGLGHSVVPATREDYDNAKDLWKGSWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADC*
Ga0102888_111446613300008995EstuarineKYNPPSVGLGHKWIPATREDYNNAKDLWKGDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLSERGGWCSGYDGCEGTPLPDQAPGLSTDC*
Ga0102816_125451713300008999EstuarineMKFFAIAALAAAVEASAGTPPAVGLGHAYVPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0102960_131275723300009000Pond WaterMKSFVLAAIAAVVSAGAPPTVGLGHAVIPQTREDYDNAKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
Ga0102963_119190013300009001Pond WaterMKFFAIAALIAAVNAGSPPTVGLGHATVPATREDYDNAKDLWKGNWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDC*
Ga0102963_120340413300009001Pond WaterMISLKIFICHKRIPILIIIYNPIIMKVIAIAALFALANAGSPPTVGLGHGTIPANREDYDNAKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADC*
Ga0102813_111714623300009003EstuarineMKFAVAALIAIAQAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0102813_118657413300009003EstuarineVINKFYNYIINTKMKFTILALVATVAAGTPPAAGLGHPIIPATREDFDNAKGVWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0103706_1016034513300009022Ocean WaterPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0103706_1017817813300009022Ocean WaterMKLFAIAALFAAAQAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF*
Ga0103707_1007150813300009025Ocean WaterFINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0103707_1012267813300009025Ocean WaterTMKYFALAALIAAASAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH*
Ga0103707_1014058613300009025Ocean WaterAVGLGHAYIPATREDYDNGKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0103708_10011257413300009028Ocean WaterINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0103708_10023706913300009028Ocean WaterKKMDKIAARASTGNVAAIVRGLSAGMKFAIAALIATVSAGLPPAVGLGHAFIPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF*
Ga0102830_117008023300009059EstuarineLATPPTVGLGHAYIPANREDFDNGKELWKGDWKKYRASRPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSADH*
Ga0115566_1038025513300009071Pelagic MarineMRIIIIIIIINNLKMKFFALAALLAIAEAGTPPTVGLGHGVVPATREDYDNAKDLWKGSWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADC*
Ga0115566_1044081113300009071Pelagic MarineMKLFAIAALFAAVNAGTPPTVGLGHSVVPATREDYDNAKDLWKGSWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADC*
Ga0115552_132818813300009077Pelagic MarineFAAVNAGTPPTVGLGHSVVPATREDYDNAKDLWKGSWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADC*
Ga0102814_1036674313300009079EstuarineMKFTLIALVATVAAGTPPSAGLGHPIIPATREDFDNAKGVWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0102814_1042225613300009079EstuarineLIFDLTIMKFILALIATAAAGPAPAVGLGHGIIPSTREDFDNSAGVWKGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC*
Ga0102815_1060861513300009080EstuarineMKFFAIAALIATTSALEGVPPTVGLGHAIIPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0118687_1008186023300009124SedimentTVGLSSRFIPRTAEDYDNGKSLWANNYAKYRAARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0114995_1066268413300009172MarineMKFTLIALIAAVNAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAGHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0114959_1036863313300009182Freshwater LakeMRFIAIVALFAATAQAGNPPPTVGLGHAYIPATRESYDNAKELWGNNWKQYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCKGTPLPDQAPGLAPDH*
Ga0103743_102846423300009195Ice Edge, Mcmurdo Sound, AntarcticaMKFAIIALVASVSAGLPPSAGLGHPIIPATREDFDNSKGVWKGDWAKYRAGHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0103872_101035213300009263Surface Ocean WaterETIIMKFFAIAALFGLASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0103872_104808213300009263Surface Ocean WaterMRCKIIFFIIIFSTKIMKFFAIAALFAAVEASAGTPPTVGLGHAIIPANREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0103872_107159713300009263Surface Ocean WaterIAIALFAAVSARRPHNYINLAIDAPAPTVGLGSAQIPANREEYDNGLTLWKNDWNAYRKARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDN*
Ga0103872_107280513300009263Surface Ocean WaterNKKGIFLYIMGLTNLIYNYIYLTTIMKFAVAALVATVAAGIPPSAGLGHPIIPATREDFDNAKGVWGGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0103742_101010643300009402Ice Edge, Mcmurdo Sound, AntarcticaMKFFAIAALFAAVEASAGTPPTVGLGHAYVPSTREDYDNAKELWKGDWAKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSYDH*
Ga0115005_1027335213300009432MarineVPYQPVGLGHEVIPANREDYNNADELWKKNWAGYVKAHPHDQDCSIAESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPEQAPGLSHD*
Ga0115005_1047937023300009432MarineMKLFALAALVAAANAGTPPTVGLGHGFVPANREDYDNAKELWKGDFAKYRAGHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0115005_1058881513300009432MarineMKFFAIAALLAATASAGSPPTVGLGHAYVPSTREDYDNAKELWKGDWSKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF*
Ga0115005_1059799813300009432MarineMKFAVAALIAIAQAGLPPSAGLGHPIIPATREDFDNAKGVWKGDWAGYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLASDC*
Ga0115005_1063134013300009432MarineMKFAVAALVAIAQAGLPPSAGLGHPIIPATREDFDNAKGVWTGDWAKYRSAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0115005_1066097813300009432MarineMKFAIVALVAIAQAGTPPSSGLGHPIIPATREDFDNAKGVWKGDWAAYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0115005_1081354713300009432MarineMKFTIIALVATASAGLPPSAGLGHPIVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0115005_1085641913300009432MarineMKFIAIALVAAVSAGTPPSSGLGHPIIPATREDFDNAKGVWKGDWAAYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0115005_1101592213300009432MarineMRFITFAALFASVEALSAAPPTVGLGHGTIPSNREDYDNGKELWKADWAAYRKARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSMDH*
Ga0115005_1131257013300009432MarineMKFAIIALVASVSAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0115005_1156981813300009432MarineMKFILATIVAVVTAGAPPAVGLGHGIIPSTREDFDNSKGVWGGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC*
Ga0115545_121729013300009433Pelagic MarineMKFAVAALIATVSAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0115562_110380423300009434Pelagic MarineVMIPRVPYQPAGLGHEVIPANREDFDNAKELWKGNWAAYVKAHPHDQDCSIAESDSWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPEQAPGLSHD*
Ga0115562_120514313300009434Pelagic MarineMKFTTIALVAVVSAGTPPSSGLGHPIVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0115562_131543213300009434Pelagic MarineMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARMCERGGWCS*
Ga0115008_1012603223300009436MarineMAAVSAGTPPTVGLGHGYVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0115008_1044606513300009436MarineMKTFAIAALLAAVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0115008_1046744913300009436MarineMKFFAIAALAAAVEASAGTPPAVGLGHAYVPATREDYDNGKELWAGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0115561_120915313300009440Pelagic MarineMKFILALIATAAAGPAPAVGLGHGIIPSTREDFDNAQGVWKGNWAGYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0115007_1053021613300009441MarineMKFAVAALIATVSAGLPPSAGLGHPIIPATREDFDNAKGVWTGDWAKYRSAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLASDC*
Ga0115007_1063293113300009441MarineMKFTIIALVATVSAGLPPSAGLGHPIVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0115007_1127400813300009441MarineMKFAIAAIVATVSAGLPPSAGLGHPIIPATREDFDNAKGVWTGDWAKYRSAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLASDC*
Ga0115563_121476813300009442Pelagic MarineMKFALIALVAIAQAGTPPSSGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0115557_122088513300009443Pelagic MarineMKFAIIALVAVAAAGTPPSSGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0115560_117620423300009447Pelagic MarineMKFALIALVAIAQAGTPPSSGLGHPIIPATREDFDNAKGVWTGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0115560_118673623300009447Pelagic MarineMKFAIAAIIATVSAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSVSKSDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0126448_107579913300009466Meromictic PondMKFYALAALIAAANAGTPPTVGLGHAYIPATREDYDNAQALWKGNWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLASDC*
Ga0115565_1043370223300009467Pelagic MarineAAPAPTVGLGHAVIPPNREEYDNGKELWKANWAAYRNSRPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGL*
Ga0115569_1034910013300009497Pelagic MarineMKFFAIAALIATATASAGTPPTVGLGHAYIPATKEDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF*
Ga0115572_1018376023300009507Pelagic MarineMIPRVPYQPAGLGHEVIPANREDFDNAKELWKGNWAAYVKAHPHDQDCSIAESDSWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPEQAPGLSHD*
Ga0115567_1076593823300009508Pelagic MarineMKFFCLIAAVAAQPSVGLASAYIPATREDYANSDELWGGNWGDYRKARPHDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH*
Ga0129287_1007719453300009538Beach Aquifer PorewaterMKFYAFAALVVAAETRNHEYVALEARPPTVGLSHSIIPPNREEYDNGKELWKGDWAAYRKARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSLDH*
Ga0115099_1082316613300009543MarineLNLFIIILIFDLTIMKFILALIATAAAGPAPAVGLGHGIIPSTREDFDNSAGVWKGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC*
Ga0115099_1089411113300009543MarinePIMKFILATIVAAVSAGAPPAVGLGHGIIPATREDFDNSKGVWGGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0115006_1113184613300009544MarineMKFAIVALVASVSAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0115013_1052462213300009550MarineIFSIINILLFPTIIMKLFAIAALFATVSAGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0115101_135385613300009592MarineMKFFAIAALFAAVEARHHHHPHNIEAVQVAGSPPKVGLGHAVIPATREDFDNAKGVWGGDWAKYRAAHPHDQDCSISESDNFKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADC*
Ga0115011_1062701213300009593MarineMKFALAALAAVQAGTPPTVGLGHGYIPANREDYDNAKELWNGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0115103_115861413300009599MarineFNYIMKFFAIAALFAAVEARHHHHPHNMEAVQVTGVPPKVGLGHAIIPANREDFDNASLYSGDFSKYRATRPHDQDCSISESDNFKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADC*
Ga0115103_148042313300009599MarineIKMKFAFALIAAINAATPPTVGLGHAWIPSNRESYDNGKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH*
Ga0115103_187559113300009599MarineRFLIYNYIYTISIMKFAVAALIATVSAGLPPSAGLGHPIIPATREDFDNAKGVWTGDWAKYRSAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0115102_1001858313300009606MarineCLIAAVAAQPSVGLASAYIPATREDYANSDELWGGNWGDYRKARPHDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH*
Ga0115102_1089763613300009606MarineLITTNLMKTIALIASAVAAMQGVPPTVGLGHSVIPSTREDYDNAQSLWGADWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH*
Ga0115102_1098558213300009606MarineFITFVALFAAVEARHHHELVGLEATPPTIGLAHAVIPANREEYDNGKELWKGNWAGYRKARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDN*
Ga0115104_1029689813300009677MarineKFFAIAALFAASASAGAPPTVGLGHQYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARVCERGGWCSGYDGCEGTPLPDQAPGLAADH*
Ga0115105_1018204313300009679MarineIIMKFFAIAALFAAVEASAGSPPSVGLGHAYIPATREDYDNARELWAGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0115105_1080807813300009679MarineMKFAVLSALVAAASAVHGTPPSVGLGHALIPANREDFDNANGLWKGDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH*
Ga0115105_1141305313300009679MarineGFGYVYIPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0115000_1082922513300009705MarineMKFTIIALVAAVSAGKPPAAGLGHPIIPATREDFDNAKGVWKGDWAAYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPEQAPGLSHD*
Ga0123371_14479413300009728MarineSIINILLFPTIIMKFFAIAALFGLASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0114960_1030766423300010158Freshwater LakeMKLYALIALLAAVEAGTPPTVGLGHAFIPANREDYDNASSLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0129348_113097923300010296Freshwater To Marine Saline GradientMKFFAIAALFGLASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0129333_1101738113300010354Freshwater To Marine Saline GradientMKFFAIAALFAAVEASAGTPPSVGLGHAYIPANREDYDNATELWKSDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0129333_1175619313300010354Freshwater To Marine Saline GradientMKYFAALVMAVAAKPHERSFIALAPPTVGLGHAIIPETREDYDNGKELWGSNWAKYRAARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDN
Ga0129324_1017471413300010368Freshwater To Marine Saline GradientMKFFAIAALVAAVEGRHHHHNIENVDLSGTPPTIGLGNQYIPASREDYDNAKEFWKGSWDKYRAAHPHDQDCGIAESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0129324_1019785913300010368Freshwater To Marine Saline GradientMKFFALAALLAIAEAGTPPTVGLGHGVVPATREDYDNAKDLWKGSWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDC*
Ga0138316_1065383213300010981MarineVGLGHAYIPANREDYDNASALWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0138316_1065383223300010981MarineAAAKAGTPPAVGLGHAYIPATREDYDNAGALWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0138324_1061779013300010987MarineKFFAIAALFAATTSAGTPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF*
Ga0138324_1062722713300010987MarineKYFAIAALIAAAKAGTPPAVGLGHAYIPATREDYDNAGALWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0138324_1062952213300010987MarineKMKFTILALVAAVSAGTPPAAGLGHPIIPATREDFDNAKGVWKGDWAAYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0138324_1068381113300010987MarineFSTIIMKYFTFAALIATAYAGTPPAVGLGHAYIPANREDYDNASALWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0136600_102925433300012036Saline LakeMKFFAIAAFVAVTEARHSHEFVALEARPPTLGLAHPIIPATTEDYDNGKELWKGDWAAYRRGRPNDQDCSLSESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH*
Ga0136600_106602223300012036Saline LakeMKLFAIAALFAAVDAATPPTIGLGHSVIPMNREEYDNGAELWKNDWAAYRRSRPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSADN*
Ga0138265_135729213300012408Polar MarineIMKFAIIALVAVASAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0138263_118916113300012415Polar MarineFAIAALIATVTAEAGTPPTVGLGHSYVPSNREDYDNAKELWKGDWAKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH*
Ga0138263_128039113300012415Polar MarineFSTIIMKFFAIAALFAAVEAKHHHSHNVEYVALAGTPPTVGLGHAYVPSTREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF*
Ga0138259_136912413300012416Polar MarineMKFFAIAALFAAVEAKHHHSHNVEYVALAGTPPTVGLGHAYVPSTREDYDNAKELWKGDWASYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF*
Ga0138259_158369813300012416Polar MarineMKFAIVALVAIASAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC*
Ga0129334_100427213300012471AqueousKMKLFALVALFAAVEAGTPPTVGLGHAYIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0129334_104315013300012471AqueousFIPMKYFAALVMAVAAKPHERSFIALAPPTVGLGHAIIPETREDYDNGKELWGSNWAKYRAARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDN*
Ga0129325_114226113300012516AqueousIIMKFFAIAALFAAVEAKHHHHNVEYVALAGTPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF*
Ga0129325_115913413300012516AqueousIMKLFAIAALFAAVNAGTPPTVGLGHSVVPATREDYDNAKDLWKGSWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDC*
Ga0129325_133316223300012516AqueousKFFAIAALIATTSALEGVPPTVGLGHAIIPANREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0129353_168139713300012525AqueousPMKFLAGLLMAVAARRPIDREYIDLAPPTVGLGHEIIPATREDYDNGKELWSSNWAKYRAARPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSVDN*
Ga0157555_108807413300012705FreshwaterLIFIKYNNNLKMKFTAIAALLAATVSAGKPPSVGLGHAYIPATREDYDNAASLWKNDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0157608_103953423300012709FreshwaterKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0157599_119102113300012715FreshwaterVKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0157605_105210813300012716FreshwaterINKKIMKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0138270_105344013300012771Freshwater LakeEYFVILFIAIVALFAATAQAGNPPPTVGLGHAYIPATRESYDNAKELWGNNWKQYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCKGTPLPDQAPGLAPDH*
Ga0160423_1044672923300012920Surface SeawaterMKFFAIAALFAAVEASAGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0160423_1045119613300012920Surface SeawaterMKFAVAALIAAVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0163110_1142881313300012928Surface SeawaterMKYFAIAALLAAAQAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0163180_1092512913300012952SeawaterMKFGVFSALVAAASAVHGTPPSVGLGHALIPANREDYDNAKDLWKGDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH*
Ga0163179_1013204333300012953SeawaterMKLAVFSALVAAASAVHGTPPSVGLGHALIPANREDFDNANGLWKGDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH*
Ga0163179_1031554443300012953SeawaterMKLFALAALFAAANAGTPPTVGLGHGFVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0163179_1055598623300012953SeawaterMKFFALAALIATASAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0163179_1059268323300012953SeawaterMKYFALAALLAVAQAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0163179_1064792813300012953SeawaterMKFYAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0163179_1071556723300012953SeawaterMKFLAAALLGLVSAGTPPSVGLGHALIPANREDFDNAKDLWKNDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH*
Ga0163111_1133520413300012954Surface SeawaterMKFFALIAAVAAQPSVGLASAYIPATREDYSNSDELWGGNWGDYRKARPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH*
Ga0163111_1209030213300012954Surface SeawaterMKFFAIAALFAATTSAGTPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF*
Ga0129335_119022313300012962AqueousLFSTIIMKFFAIAALFAAVEASAGTPPSVGLGHAYIPANREDYDNATELWKSDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0129341_100107723300012966AqueousIINILLFPTIIMKFFAIAALFGLASAGAPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0129337_121603723300012968AqueousMKFTLALIAAVAARHHHEYVGLEANPPTVGLSSRFIPRTTEDYDNGRQLWGNNYAKYRAARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0129337_127487913300012968AqueousLIINILLFSTIIMKFFAIAALFAAVEASAGTPPSVGLGHAYIPANREDYDNATELWKSDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0129338_100914313300012970AqueousLLFSTIIMKFFAIAALFAAVEASAGTPPSVGLGHAYIPANREDYDNATELWKSDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRAARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0129338_101038213300012970AqueousIPMKYFAALVMAVAAKPHERSFIALAPPTVGLGHAIIPETREDYDNGKELWGSNWAKYRAARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQASGLSTDN*
Ga0129338_103274613300012970AqueousLSLMKFVVIAALFAVIHADEDSDEKKGKKYNPPSVGLGHKWIPATREDYNNAKDLWKGDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDC*
Ga0171651_112713813300013115MarineMKLFALAALFAAVNAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC*
Ga0170791_1262495513300013295FreshwaterFAAVEAGTPPTVGLGHAFIPGNREDYDNASSLWKSNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH*
Ga0180057_104350413300016697FreshwaterIMKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0182045_131516213300016726Salt MarshKVIAIAALFALANAGSPPTVGLGHGTIPANREDYDNAKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDC
Ga0182056_135076613300016729Salt MarshMKFFAIAALFGLASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0182047_123850013300016737Salt MarshMKFTLAALIAAVSAGSPPAVGLGHAYIPATREDYDNAKELWKSNWAKYREAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0182076_117742113300016739Salt MarshFVAALVMAVAAKPHERSFVALAPPTVGLGHAIIPETREDYDNGKELWSSNWAKYRAARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDN
Ga0182096_120684913300016740Salt MarshKFITFVALFAATEARHHHEYVALEARPPTVGLSHSVIPANREDYDNGKELWKGDWAAYRRARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSLDH
Ga0182079_108956813300016741Salt MarshKFTIAALVAAVYAGKPPSVGLGHAFIPATREDYDNAKELWKSNWAKYREAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0182055_140521613300016746Salt MarshMKVIDIAALFALANAGSPPTVGLGHATIPANREDYDNAKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDC
Ga0182053_108812313300016749Salt MarshQTCGCSQGSSNTRAWGWSTWVRLVGYHYELDRGAALIATVSATEGAPPTVGLGHSIIPANREDYDNAKELWKGDWAHYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0182070_113177713300016758Salt MarshPMKFVAALVMAVAAKPHERSFVALAPPTVGLGHAIIPETREDYDNGKELWSSNWAKYRAARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTD
Ga0186577_10470013300016882Host-AssociatedMKFFAIAALFAAVEAKHHHHNTEFVDISGKPPAVGLGHAVIPATREEYDNAATLWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLASDC
Ga0186684_11837013300017280Host-AssociatedQLIIIIKFIMKFTVFAALVAATQAGHPPAVGLGHAIVPATREDYDNAKELWKNDWAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADN
Ga0180120_1023020913300017697Freshwater To Marine Saline GradientMKFFCLIAAVAAQPSVGLASAYIPATREDYSNSDELWGGNWGDYRKARPHDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH
Ga0181387_102756023300017709SeawaterMKFFAIAALFAAVEASAGKPPAVGLGHAVIPATREDYDNAKEFWKGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181391_108245623300017713SeawaterMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181428_114785813300017738SeawaterMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCCISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181428_116599413300017738SeawaterMKFFAAALLGLVSAGTPPSVGLGHALIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0181407_109770223300017753SeawaterMKFYAIAALFAAVEASAGAPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181411_116561513300017755SeawaterRLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181420_112577113300017757SeawaterEDPKTPKPQNPKTPNIRNATAEILLSNILNFVNILSIINILLFPTIIMKFFAIAALFAAVEASAGAPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181410_122652613300017763SeawaterGLASAYIPATREDYANSDELWGGNWGDYRKARPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH
Ga0181385_116403213300017764SeawaterAALFAAVEASAGAPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181413_116149713300017765SeawaterREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181406_109373323300017767SeawaterMMKFAIAALLGAVSAGTPPAVGLGHAYIPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181406_122487913300017767SeawaterMKFFAIAALFAAVEASAGTPPAVGLGHAYVPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0187220_109017413300017768SeawaterNPKTPKPQNPKTPNIRNATAEILLSNILNFVNILSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0187220_119579613300017768SeawaterMKFYAIAALVAAAQAGSPPAVGLGHAVIPATREDYDNAKELWKGDWAKYRAAHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0181430_108404423300017772SeawaterMKFILATIVAAVSAGAPPAVGLGHGIIPATREDFDNSKGVWGGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0181380_123562213300017782SeawaterMKFAVAALIATVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0181379_112603623300017783SeawaterMKIVAIAALFAAVQAGSPPSVGLGHAYIPSTREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181584_1017144313300017949Salt MarshMKFTLALIAAVAARHHHEYVGLEANPPTVGLSSRFIPRTGEDYDNGKALWANNYAKYRAARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPD
Ga0181577_1043127513300017951Salt MarshMKSFVLAAIAAVVSAGAPPTVGLGHAVVPQTREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0181577_1044705613300017951Salt MarshMKFFAIAALIAAVNAGSPPTVGLGHATVPATREDYDNAKDLWKGNWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDC
Ga0181577_1049268013300017951Salt MarshMKVIAIAALFALANAGSPPTVGLGHATIPANREDYDNAKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDC
Ga0181580_1063178113300017956Salt MarshMKFTLALIAAVAARHHHEYVGLEANPPTVGLSSRFIPRTGEDYDNGKALWANNYAKYRAARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPD
Ga0181571_1042064913300017957Salt MarshMKSFVLAAIAAVVSAGAPPTVGLGHAVVPQTREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181589_1085723013300017964Salt MarshFVALAPPTVGLGHAIIPETREDYDNGKELWSSNWAKYRAARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDN
Ga0181590_1067613013300017967Salt MarshMKFTIAALVAAVYAGKPPSVGLGHAFIPATREDYDNAKELWKSNWAKYREAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181587_1066033113300017968Salt MarshVPPTVGLGHAVIPATREAYDNAKELWKGNWASYRSSRPNDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDN
Ga0181569_1044207823300017986Salt MarshMKFFAIAALFAAEASAGTPPTVGLGHAYVPATREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0181569_1044384313300017986Salt MarshMKSFVLAAIAAVVSAGAPPTVGLGHAVIPQTREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181569_1045038813300017986Salt MarshMKFTIAALVAAVSAGSPPQVGLGHAYIPATREDYDNAKELWKSNWAKYREAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181579_1042381813300018039Salt MarshYAGKPPSVGLGHAFIPATREDYDNAKELWKSNWAKYREAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0181579_1048113013300018039Salt MarshMKFIAIAALFATVDALAPPTVGLGHAIIPSNREDYDNGKELWKSNWANYRKARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPEQAPGLLPDN
Ga0181561_1029785913300018410Salt MarshMKVIAIAALFALANAGNPPTVGLGHGTIPANREDYDNAKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0181560_1029978013300018413Salt MarshMKVIAIAALFALANAGSPPTVGLGHGTIPANREDYDNAKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0181567_1054740713300018418Salt MarshMKVIAIAALFALANAGSPPTVGLGHATIPANREDYDNAKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPIPDAAPGLAPDC
Ga0181563_1042784823300018420Salt MarshMKVIAIAALFALANAGSPPTVGLGHGTIPANREDYDNAKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDC
Ga0181592_1042600123300018421Salt MarshMKFTLALIAAVAARHHHEYVGLEANPPTVGLSSRFIPRTGEDYDNGKALWADNYAKYRAARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPD
Ga0181592_1079075713300018421Salt MarshPATREDYDNAKELWKGDWAAYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDN
Ga0181591_1084969013300018424Salt MarshMKFFAIAALFAAVEARHHHHNTEFVGLEGKPPTVGLGHAIIPQTREDYDNAKELWKGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192960_10580713300018515MarineTWGSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0188858_10950613300018567Freshwater LakeMKTIAIAALFAAVSARRPQNYQNLAIDAAPPTVGLGHEVVPVTREDYDNGKELWKNNWANYRKARPNEQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSVDN
Ga0193474_101818613300018575MarineMKYFALAALIAATSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193060_101871913300018596MarineTWGIINILLFPTIIMKAFALAALFATVSAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193182_102519413300018602MarineTWGNILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192881_102410513300018603MarineMKFSAIAALLATVSAGSPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0193339_102918513300018605MarineMGIINILLFPTIIMKFFAIAALFGAVSAGTPPAVGLGHAYIPATREDYDNGKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192959_104499313300018609MarineMGIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193133_102294713300018617MarineHGENILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREEYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193204_102028113300018618MarineMGNILLFPTIIMKFILAALLGAVSAGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192842_103747513300018625MarineHGENILLFPSIIMKIFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193355_102346813300018628MarineHGEYFTIINILLFPTIIMKAFALAALFATVSAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193355_102461013300018628MarineMKFVLAALVAAVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193355_102477713300018628MarineMKYFALAALIAAAKAGTPPAVGLGHAYIPATREDYDNAGALWAGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193355_102516013300018628MarineMKFALAALIAAVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193355_102527113300018628MarineMKFVLAALVAAVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193355_102642413300018628MarineMKFALAALIAAVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0193355_102712113300018628MarineMKYFALAALIAAAKAGTPPAVGLGHAYIPATREDYDNAGALWAGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193355_103153813300018628MarineMGNNKLIIMKYFALAALIAAAKAGTPPAVGLGHAYIPATREDYDNAGALWAGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPD
Ga0193355_103204613300018628MarineMKFALAALIAAVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193504_103248213300018653MarineEDFLKPASKASVPLEDDPARRVPGEPAATARGLGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192846_103353313300018655MarineNILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192846_103505213300018655MarineMKFSAIAALFAATTSAGTPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARVCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0192906_104121813300018658MarineFPTIIMKFFAIAALFGAVSAGTPPAVGLGHAYIPATREDYDNGKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193122_105953413300018661MarineMKYFAIAALLAAVKAGTPPAVGLGHAYVPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192819_104876013300018670MarineMKFFAIAALLAVEASAGTPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0193571_101878513300018671MarineGNILSIINILLFPTIIMKFFAIAALFGAVSAGTPPAVGLGHAYIPATREDYDNGKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193571_101989213300018671MarineIYNNIKLMKFFAIAALVASVSASAGTPPTVGLGHAYVPANREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0193166_102574613300018674MarineMGINILLFPTIIMKFYAIAALFAAVEASAGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193166_102732413300018674MarineMGIIIIIKNQMKFFALAALIATATASAGTPPSVGLGHAYVPSTREDYDNAKELWKGDWAKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0193206_103341313300018681MarineMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192983_105564013300018684MarineMKFITFAAIFASVEATKMNAAPPTVGLGHEVIPSNREDYDNGKELWKADWAKYRKARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSMDH
Ga0192944_105329413300018692MarineMKFILATIVAVVTAGAPPAVGLGHGIVPATREDFDNSKGVWGGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0193405_104515413300018701MarineLLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193274_103130623300018703MarineMGIIIYILKLIILMKFVLAALVAAVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193349_105747413300018714MarineTWGSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193349_106252713300018714MarineMKFFAIAALFAAEASAGTPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0193517_106464513300018725MarineMKFAVFSAFVAAASAVHGTPPSVGLGHALIPANREDFDNAKDLWKSDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193517_106900113300018725MarineMKFAVFSAFVAAASAVHGTPPSVGLGHALIPANREDFDNAKDLWKSDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193517_107330413300018725MarineMKSFVLAALAALASAGTPPTVGLGHAFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0192967_104272923300018730MarineMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192967_104362113300018730MarineMKIFAIAALLAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193544_102746113300018735MarineRLFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193534_106655313300018741MarineNILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193138_103243813300018742MarineILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193138_105854213300018742MarineKYFALAALLAAVNAGTPPAVGLGHAYIPANREDYDNASALWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193000_104028913300018745MarineTWGNILLFPTIIMKFFAIAALFGAVSAGTPPAVGLGHAYIPATREDYDNGKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193468_106554213300018746MarineIIMKFFAIAALFAAVEASAGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193392_105649213300018749MarinePTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193058_106092213300018758MarineMKFAVFSALVAAAAAVHGTPPSVGLGHALIPANREDFDNGKELWKGDWAKYRGAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193058_107050513300018758MarineMKFAVFSALVAAAAAVHGTPPSVGLGHALIPANREDFDNGKELWKGDWAKYRGAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192827_106061813300018763MarineVISKGLEFEMSQQDFTQARRGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192827_108075713300018763MarineTWGNILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192827_108239713300018763MarineMGINILLFPTIMMKFAIAALLGAVSAGTPPAVGLGHAYIPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193031_104326013300018765MarineMGNSIINKLLFPTIIMKYFALAALIATVSAGTPPAVGLGHAYVPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193031_107051113300018765MarineMKYFTFAALIATAYAGTPPAVGLGHAYIPANREDYDNASALWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193031_107892713300018765MarineMKFFAIAALFAAEASAGTPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDFXESYGAQPAQTVILXYI
Ga0193031_108253113300018765MarineMKYFAIAALIAAAKAGTPPAVGLGHAYIPATREDYDNAGALWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDC
Ga0193031_108375313300018765MarineMGNNNFIVSTIIMKYFTFAALIAVAYAGTPPAVGLGHAYIPANREDYDNAAALWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193031_108400413300018765MarineMKFSVFALLGSVSAGTPPSVGLGHALIPANREDFDNAKDLWKSDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193031_108402213300018765MarineMKFAFALIAAINAATPPTVGLGHAWIPSNRESYDNGKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0193031_108567113300018765MarineTWGLLIIINNIMKFFALAALIATTSAGTPPTVGLGHAYVPATREDYDNSKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0193031_109150213300018765MarineHGDNNIIMKYFAIAALIAAAKAGAPPAVGLGHAYIPATREDFDNAADVWKGNWASYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADC
Ga0193031_109366213300018765MarineTWGIILIFDLTIMKFILALVATVAAGPAPAVGLGHGIIPATREDFDNSAGVWKGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0193181_103646013300018766MarineGLQNILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193570_102442613300018774MarineGNILLFPTIIMKFFAIAALFGAVSAGTPPAVGLGHAYIPATREDYDNGKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193407_107057913300018776MarineTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193149_106738213300018779MarineMKFILAALVAAVSAGTPPTVGLGHAFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0192832_105981413300018782MarineMGSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193124_104194913300018787MarineTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193117_107011013300018796MarineMKFFAIAALFAAVEASAGAPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193306_107315813300018800MarineKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192824_110648813300018801MarinePLEFVLSQQDYTQARRGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0194242_1000228213300018818MarineMKFFAIAALFGAVSAGTPPAVGLGHAYIPATREDYDNGKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193053_107487313300018823MarineFINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193191_105688713300018830MarineFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192949_107069313300018831MarineSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0194240_101277413300018832MarineMGTIINILLFPTIIMKFFAIAALFGAVSAGTPPAVGLGHAYIPATREDYDNGKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0194240_101286213300018832MarineHGDYNYILLFPIMKVFAIAALLGLAAAGTPPAVGLGHAYVPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0194240_103255813300018832MarineHGDLYNNIKLMKFFAIAALVASVSASAGTPPTVGLGHAYVPANREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0192870_109111713300018836MarineFSTIIMKYFTFAALIATAYAGTPPAVGLGHAYIPANREDYDNASALWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192870_109395913300018836MarineFVLAALLAAAKAGTPPAVGLGHAYVPATREDYDNAGALWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193302_105748013300018838MarineSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193219_107599813300018842MarinePTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNANELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193253_109397613300018846MarineNILLFPTIIMKFFAIAALAAAVEASAGTPPAVGLGHAYVPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193253_109499913300018846MarinePGINLIFINMKYFVIAALVAAAQAGSPPAVGLGHAVIPATREDYDNAKELWKGDWAKYRAAHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193253_113822513300018846MarineKFFALIAAVAAQPSVGLASAYIPATREEYANSDELWGGNWGDYRKARPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH
Ga0193005_108230413300018849MarineKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192958_113896713300018853MarineFVNILSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193475_105299723300018855MarineMKFAIFVALASAAAPPSVGLGHAIIPANREDYDNGRELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193475_106007413300018855MarineMGTIINILLFPTIIMKAFALAALFATVSAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193475_107064413300018855MarineMKFAVAALIATVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193475_107961613300018855MarineMKFFTAALLGLVSAGTPPSVGLGHALIPANREDYDNAKDLWKSDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0193475_107990313300018855MarineMKFFTAALLGLVSAGTPPSVGLGHALIPANREDYDNAKDLWKSDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193192_105807413300018860MarineMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193192_106058513300018860MarineTWVLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193308_108365213300018862MarineLFPTIIMKYFAIAALLGVAAAGTPPAVGLGHAYVPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193308_108825413300018862MarineVSTIIMKYFTFAALIAVAYAGTPPAVGLGHAYIPANREDYDNASALWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192978_106683813300018871MarineGKHITMKFTIALLIAAVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0192978_108468413300018871MarineGKHITMKFTIALLIAAVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0192978_110573613300018871MarineMKFILVALVATAAAAAPPAVGLGHGIIPATREDFDNSKGVWKGDWAKYRAGHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0193553_115325013300018873MarineHGENILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192977_107426913300018874MarineMKFFAIAALFAAVEAKHHHSHNVEYVALAGTPPTVGLGHAYVPSTREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0193027_107285613300018879MarineFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYVPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193337_104448713300018880MarineTWGNILLFPTIMMKFAIAALLGAVSAGTPPAVGLGHAYIPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193090_114203313300018899MarineMKFTAFAALVAGVSAAPAVGLGHAIIPATREDYDNGKELWKGDWAKYRAAHPNDQDCSISESDSWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0192868_1006985013300018913MarineMKFILAFLATVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0192868_1007216413300018913MarineDNNIKLMKFFALAALVASVTASAGTPPTVGLGHAYVPSNREDYDNAKELWKGDWAKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPD
Ga0192868_1007998113300018913MarineTWGNILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192989_1011466213300018926MarineLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPD
Ga0192989_1011936913300018926MarineIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193260_1011343413300018928MarinePTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193260_1013395213300018928MarineMKFILAALIATVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRGAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193260_1014802813300018928MarineIMKFILALVATVAAGPAPAVGLGHGIIPATREDFDNSAGVWKGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0192820_1014100613300018932MarineHGENILLFPTIIMKFFAIAALFAAVEAXXXTWGTPPAVGLGHAYIPATREDYDNGKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192820_1017105013300018932MarineHGENILLFPTIIMKFFAIAALFAAVEAXXXVEASAGTPPAVGLGHAYIPATREDYDNGKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193552_1020902823300018934MarineTWGIINILKLITLMKFALIALVATVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193552_1022119713300018934MarineTWEFIIEKHITMKFALAALFAAANAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193552_1022535913300018934MarineTWGIEKHITMKFALAALIAAVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPD
Ga0193426_1013683813300018942MarineHGIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193426_1015849213300018942MarineMKFVVAALVGLASAGTPPTVGLGHAFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0192985_124543213300018948MarineFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192894_1033574513300018968MarineTWGIIYLFIKTNRMKFAAIAALIAVVSAGAPPAVGLGHAFIPATREDFDNAKGLWKGDWAKYRAAHPHDQDCSISESDAWKGAQQCSRSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0192873_1040855913300018974MarineMKFAVAALIATVSAGTPPTVGLGHGYVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192873_1040877313300018974MarineMKFILAALVAAVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0192873_1043043813300018974MarineMGIINILLFPTIIMKFFAIAALFAAVEASAGAPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193006_1022732823300018975MarineMKFVLALVATAMASAPPAVGLGHAIIPANREDYDNGKELWKGDWAKYRGAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193006_1023784013300018975MarineMKYFAIAALVAFVKAGTPPAVGLGHAYIPATHEDFDNAAGVWKGDWAAYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDC
Ga0193006_1025576813300018975MarineMKIFAIAALFAAVQAGTPPSVGLGHAYIPATREDYDNAKELWAGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193254_1014446913300018976MarineLIFINMKYFVIAALVAAAQAGSPPAVGLGHAVIPATREDYDNAKELWKGDWAKYRAAHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193353_1017528713300018977MarineMKFVLAALIAAVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0193353_1019095413300018977MarineMKYFALAALLAAVNAGTPPAVGLGHAYIPANREDYDNAQALWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193353_1021633813300018977MarineHGELIINNLLILPIIMKYFALAALIAAAKAGVPPAVGLGHAYIPANREDYDNASALWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193353_1023010513300018977MarineHGDNYIIFDLIIMKFLALALLGTVSAGAPPSVGLGHGVIPSTREDFDNAAGVWKGDWAAYRGARPHDQDCSIAESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0193353_1023251413300018977MarineMGNILLFPTIIMKFFAIAALFAAVEAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193540_1011191513300018979MarineMGILNFVNILSIINILLFPTIIMKFFAIAALFAAVEASAGAPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193540_1020185313300018979MarineMKFVLALIASVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0192961_1006941623300018980MarineMKFILATIVAAVSAGAPPAVGLGHGIIPATREDFDNSKGVWAGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0192961_1013324113300018980MarineSTQSTWGSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192961_1017113723300018980MarineTWDNNLLLMRFFAIAALIATVTAEAGTPPTVGLGHSYVPANREDYDNAKELWKGDWAKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0192961_1021186313300018980MarineHGDNYIYTISIMKFAVAALIATVSAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0192961_1022030613300018980MarineHGDNYIYTISIMKFAVAALIATVSAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADCXDACINIRCXSHSMIMVVYDTLIYLR
Ga0192961_1022215513300018980MarineMKFFAIAALFAAVEAKHHHSHNVEYVALAGTPPTVGLGHAYVPSTREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0192961_1023668013300018980MarineTWGIILIFDLTIMKFILALIATAAAGPAPAVGLGHGIIPSTREDFDNSSGVWKGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0192961_1024426813300018980MarineMGNFYNXKHITMKLFALAALFAAVQAGTPPTIGLGHGYVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDCXSACXSDFKLLCILRTMLSGPRFVKSFIPD
Ga0192961_1024710723300018980MarineTQSTWGINLIFINMKYFVIAALVAAAQAGSPPAVGLGHAVIPATREDYDNAKELWKGDWAKYRAAHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0192961_1025616113300018980MarineHGDNYIYTISIMKFAVAALIATVSAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0192968_1010913713300018981MarineHGESIINILLFQTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192947_1012384813300018982MarineMKFIAIAALFASVDAMNVNAPAPTVGLGHSVIPANREDYDNGKELWKANWAAYRKARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDN
Ga0192947_1013338113300018982MarineMKFIAIVALFASVDAMNVDAAPPTVGLGHGTIPSNMEEYDNGKELWKANWAAYRKARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDN
Ga0192947_1023506013300018982MarineMKFIAIAALFASVDAMNVNAPAPTVGLGHSVIPANREDYDNGKELWKANWAAYRKARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0192947_1023800413300018982MarineTWGIILIFDLTIMKFILAALVATIAAGPAPAVGLGHGIIPATREDFDNSAGVWKGDWAKYRAGHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0192947_1027266213300018982MarineMGNIIYYIFLQLKMKVIAIALIACVSAQAPPAVGLGHAYIPATREDYDNGRELWRGDWSKYRGAHPNDQDCGISESDNWKGAQQCAQSWECRGARVCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193554_1033447513300018986MarineMKFILAFAAAVSAGTPPTVGLGHAFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYMDVRVPHSQIKLQDSFQTAEQTITS
Ga0193275_1021137413300018988MarineVFAVVVMVHAIYAVTPPAVGLGHAYIPATREDYDNGHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193030_1015336213300018989MarineTWGSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193030_1015336313300018989MarineTWGSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193030_1015336413300018989MarineMKYFALAALVATVSAGSPPAVGLGHAYIPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193030_1015996413300018989MarineMKLIAIALIACANAQAPPAVGLGHAYIPATREDYNNGSELWRGDWAKYRAAHPNDQDCGISESDNWKGAQQCAQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193030_1016079413300018989MarineTWGNILLFPTIIMKYFAIAALLGAVSAGTPPAVGLGHAYIPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193030_1016079513300018989MarineTWGNILLFPTIIMKYFAIAALLAAVKAGTPPAVGLGHAYVPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193030_1016367013300018989MarineMKFFALAFIAAVSAEKPPAVGLGHAYVPATREDFDNGKELWKGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193030_1019879413300018989MarineNMGNNNFIVSTIIMKYFTFAALIAVAYAGTPPAVGLGHAYIPANREDYDNAAALWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193030_1025501913300018989MarineMKFSVFSALVAAAAAVHGTPPSVGLGHALIPANREDYDNAKELWKGDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193030_1025577323300018989MarineMKFILAALIASVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193030_1026197713300018989MarineTQSTWGSFYNWKHITMKFALIALIATVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193030_1027148413300018989MarineMKFILAALIATVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193030_1027979213300018989MarineMKYFALAALLAVAKAGTPPAVGLGHAYIPANREDFDNAAEVWKGNWAAYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDC
Ga0193030_1028468913300018989MarineMKFVLAALVATVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193030_1030040313300018989MarineMKFAFALIAAINAATPPTVGLGHAWIPSNRESYDNGKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193030_1031161113300018989MarineMGIIINILKLITLMKFALIALVATVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDWAKYRAAHPADQDCGISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193034_1013482713300019001MarineMKIFAIAALLAAVQAGTPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193034_1017789313300019001MarineMKLFALAALFAAANAGTPPTVGLGHGFVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193034_1018783913300019001MarineMKFLAAALLGLVSAGTPPSVGLGHALIPANREDFDNAKDLWKNDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193033_1013596013300019003MarineQRGLRPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193044_1024660113300019010MarineSTQSTWGIILIFDLTIMKFILALLATVAAGPAPAVGLGHGIIPSTREDFDNSAGVWKGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0193044_1025808513300019010MarineTWGNILLFPTIIMKFFAIAALAAAVEASAGAPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193044_1026374713300019010MarineTGGLLIIINNIMKFFALAALIATTSAGTPPTVGLGHAYVPSTREDYDNSKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARVCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0193044_1027419013300019010MarineTWDLYNNIKLMKFFALAALVASVTASAGTPPTVGLGHAYVPSNREDYDNAKELWKGDWAKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0193044_1028116013300019010MarineMKFFAIAALFAAVEASAGTPPAVGLGHAVIPATREDYDNAKEFWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCAQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0193569_1027302213300019017MarineDYDNSIINILLFPTIIMKFFAIAALFGAVSAGTPPAVGLGHAYIPATREDYDNGKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192982_1031583013300019021MarineHGDNYIYSISIMKFAVAALIAIAQAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0192982_1032197413300019021MarineSTQSTWGIIFLIIMKFTAIAALVATVSAGSPPAVGLGHAVIPANREDYDNGKELWKGDWAKYRAGHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0192982_1036722813300019021MarineMKFALVALIAAVSAGTPPTVGLGHGFVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0193535_1024921113300019024MarineAGSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193545_1013991413300019025MarineGNYINFSTITMKFFAIAALFAAVEASAGTPPTVGLGHAYVPSTREDYDNAKELWKGDWAKYRTTHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0192909_1013037823300019027MarineMKYFALAALIAAAKAGTPPAVGLGHAYIPATREDYDNSAALWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192909_1022879913300019027MarineMGLFPTIIMKFFAIALFAAVEASAGTPPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192909_1029054713300019027MarineMRFAAFAALVGIASAGTPPTVGLGHAYVPANREDYDNAKELWKGDFAKYRGAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193516_1021639113300019031MarineMKYFALAALLAAVNAGTPPAVGLGHAYIPANREDYDNAAALWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193516_1022148313300019031MarineMKYFTLAALFATVNAGSPPSVGLGHALIPANREDYDNAAALWKNDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193516_1024774113300019031MarineMKYFTFAALLATVSAGTPPSVGLGHALIPANREDYDNGKELWKGDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193516_1026646913300019031MarineMKFTIALIAAINAATPPTVGLGHAWIPSNREDYDNGKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193516_1026809613300019031MarineMKFVLALVATAMASAPPAVGLGHAIIPANREDYDNGKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193516_1028107113300019031MarineMKFLLAFLATVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193516_1028630313300019031MarineMKYSLFAALAATVSAGTPPSVGLGHALIPANREDFDNAKDLWKSDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193516_1029079413300019031MarineMGNNNIILFSTIIMKFVLLALIGAVSAGTPPAVGLGHPYIPANREDYDNAKELWKGDWAKYRAAHPADQDCGISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193516_1029258313300019031MarineMKFVLALLVASVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRSAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193516_1031267613300019031MarineHGIILMKTIACLMALVSAATPPTVGLGHSFVPANREDFDNGKELWKGNWAQYRSAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERTGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192869_1026449613300019032MarineMKYFTFAALIAVAYAGTPPAVGLGHAYIPANREDYDNASALWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192869_1028496213300019032MarineTWGIIIMKYAIALIAAVAAQPSVGLASAFIPATREDYDNAGELWAGNWADYRKARPHDQDCSLSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192869_1033462313300019032MarineMKFAFALIAAINAATPPTVGLGHAWIPSNREDYDNGKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192869_1033919213300019032MarineMKFAIAALVAIASAGVPPSSGLGHPIIPATREDFDNAKGVWGGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192869_1036334913300019032MarineMKYFAIAALIANVYAGAPPAVGLGHALIPANREDYDNAAELWKGNWAAYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDC
Ga0192869_1048325113300019032MarineTWGINLIFINMKFYAIAALVAAAQAGSPPAVGLGHAVIPATREDYDNAKELWKGDWAKYRAAHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADCXDGXINIXCXSPEMIMVVYDTLIYLR
Ga0192869_1048934413300019032MarineMGIILIMKYAFAALIAMVAAQPSVGLASGYIPATREDYDNAKELWAGNWGDYRKARPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193037_1030631313300019033MarineMKLFAIAALFAAANAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193037_1031649213300019033MarineHGDNYIIFDLIIMKFIAIVALTATVSAGRPPAVGLGHAVIPSTREDFDNAQGVWKGDWAAYRAGHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0192945_1012433523300019036MarineMKYFVIAALVAAAQAGSPPAVGLGHAVIPATREDYDNAKELWKGDWAKYRAAHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0192945_1014092513300019036MarineSTWGSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192945_1026995213300019036MarineHGDLYNNIKLMKFFALAALVASVTASAGTPPTVGLGHAYVPSNREDYDNAKELWKGDWSKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARVCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0192945_1027085313300019036MarineMKFSIVALVATVAARHHHHEYVALDARPPTVGLASGYIPHTKEDYDNGKTLWAANYKKYRAARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192945_1027240613300019036MarineHGDLYNNIKLMKFFALAALVASVTASAGTPPTVGLGHAYVPSNREDYDNAKELWKGDWSKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0192945_1027329613300019036MarineTWGYNNKIHMKFFALAALIATATASAGTPPSVGLGHAYVPSTREDYDNAKELWKGDWAKYRTTHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0192945_1027490213300019036MarineMKFAIVALVASVSAGLPPSAGLGHPIVPATREDFDNAKGVWAGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0192945_1027744013300019036MarineMGNYINFDLTIMKFILALLATVAAGPAPAVGLGHGIIPATREDFDNSAGVWKGDWAKYRAGHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0192945_1028783113300019036MarineTWGTLIIMKFFALVAIASAQAPPAVGLGHAYIPATREDYDNGRELWKGDWSKYRAAHPNDQDCGISESDNWKGAQQCAQSWECRGARVCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192886_1030965113300019037MarineMGTMKYFALAALLAAANAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193123_1032778413300019039MarineLFFIFFFSIINILLFPTIIMKYFAIAALLAAVKAGTPPAVGLGHAYVPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193123_1041546123300019039MarineMKFFAIAALLAVEASAGTPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0192857_1017944323300019040MarineMGILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193336_1053752213300019045MarineMKFIAIVALFATVEAATPPTVGLGHAVIPANREDYDNGKELWKANWANYRKARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSVYN
Ga0193336_1054432813300019045MarineMGKFYNWKHITMKFALAALIATVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDC
Ga0193336_1055108613300019045MarineTQSTWGNILLFPTIIMKIIAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193336_1056516113300019045MarineEYMGNILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNANELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193336_1058247913300019045MarineMKFIAIAALFAAVDAAAPPTVGLGHAIIPATREDYDNGKELWKANWANYRKARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSVDN
Ga0193336_1060475113300019045MarineMKFALAALIASVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193336_1060501013300019045MarineMKFAVAALIAAVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193336_1063186913300019045MarineTWGIILIFDLTIMKFILALVATVAAGPAPAVGLGHGIIPATREDFDNAQGVWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDN
Ga0192981_1020252913300019048MarineMKFAIACLIAAVSAGTPPTVGLGHGFVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0192981_1026336713300019048MarineHGQRRVHGDNYIYLISIMKFAIVALVAIAQAGLPPSAGLGHPIIPATREDFDNAKGVWGGDWAKYRAAHPNDQDCSISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0192981_1030165413300019048MarineMKFAIIALVATVAARHHHHEYVALEARPPTVGLASAFIPAVKEDYDNGKTLWAANYKKYRAARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSMDH
Ga0192981_1030520113300019048MarineMKFIIAALVAVSARPVDNQFVAMAPPTVGLGHEIVPANREDYDNGKELWAANWKKYRAARPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSMDH
Ga0192981_1030667013300019048MarineMKLFALAALFAAVQAGTPPTIGLGHGYVPANREDYDNAKELWKGDFAKYRAGHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0192981_1033514713300019048MarineHGDIIIDSTKMKFIAIALVSAVSAGLPPSAGLGHPIIPATREDFDNAKGVWKGDWAGYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARVCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0193082_1039731623300019049MarineMGNWKHITMKFALAALIATVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193082_1069372613300019049MarineMKYFALAALVATVSAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192966_1004624323300019050MarineHGDNNILLMKFFAIAALIATATASAGTPPTVGLGHAYVPSSREDYDNAKELWKGDWSKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0192966_1017631613300019050MarineMKIIAIASLFAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192966_1029748413300019050MarineMKFITFAAIFASVEATKMNAAPPTVGLGHEVIPSNREDYDNGKELWKADWAKYRKARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0192966_1030023413300019050MarineMKFITFAAIFASVEATKMNAAPPTVGLGHEVIPSNREDYDNGKELWKADWAKYRKARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0192966_1032029113300019050MarineMKVIAIALIACVSAQAPPAVGLGHAYVPATREDYDNGRELWKGDWSKYRGAHPNDQDCGISESDNWKGAQQCAQSWECRGARVCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192826_1007223913300019051MarineHGEFTIYVKEKTPMMKVVLVLLMATVAYTRVLGTPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192826_1028796313300019051MarineQSTWGNILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192826_1031882713300019051MarineMKFFAIAALFAVVEAGTPPSVGLGHAVVPATREDYDNAKGLWGGDWAKYRAAHPHDQDCSIAESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADC
Ga0192826_1032635913300019051MarineVHGDNNIKLMKFFAIAALVASVSASAGTPPTVGLGHQYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0192826_1036669813300019051MarineMKFFTAALLGLVSAGTPPSVGLGHALIPANREDFDNAKDLWKSDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0188830_102007013300019085Freshwater LakeMKFVVIAALFAVIHADEDSDEKKGGKKYNPPSVGLGHKWIPATREDYNNAKDLWKGDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDC
Ga0188866_101966013300019095Freshwater LakeTTIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0188866_102123513300019095Freshwater LakeFPTIIMKFFAIAALAAAVEASAGTPPAVGLGHAYVPATREDYDNGKELWAGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0188866_102185713300019095Freshwater LakeSAFAALIAVVAAQPSVGLASAYIPQTREDYNNSAELWAGNWGDYRKARPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0188866_102237813300019095Freshwater LakeTAFAALLAVVAAQPSVGLASAYIPQTREDYDNAKELWAGNWGDYRKARPHDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0188866_102735113300019095Freshwater LakeTAFAALLAVVAAQPSVGLASAYIPQTREDYDNAKELWAGNWGDYRKARPHDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH
Ga0188866_103384713300019095Freshwater LakeFVIAALVATASAGLPPATGLGSAFIPANREDYDNAKSLWKGNWAGYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0193153_103165813300019097MarineMGIINILLFPTIIMKFYAIAALFAAVEASAGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193153_103199713300019097MarineMKSFVLAALAALASAGTPPTVGLGHAFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193153_103305213300019097MarineMGDKLLLIIIIKIMKFFALAALIATASAGTPPTVGLGHQYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARVCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193153_103402113300019097MarineMGIIFIMKSAIAALIAVVAAQPSVGLASAYIPQTREDYNNSAELWAGNWGDYRKARPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192946_105139413300019103MarineMGELIYNYINFDLTIMKFILALLATVAAGPAPAVGLGHGIIPATREDFDNSAGVWKGDWAKYRAGHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0192946_105509913300019103MarineTWGLLIIINNIMKFTALAALLATASAGAPPTVGLGHQYVPSTREDYDNSKELWKGDWAKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARVCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0192946_106406713300019103MarineMKYFALAALIAAASAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193243_104964413300019116MarineMGNILNFVNILSIINILLFPTIIMKFFAIAALFGAVSAGTPPAVGLGHAYIPATREDYDNGKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193243_105130613300019116MarineTWGLLIIINNIMKFFALAALIATTSAGTPPTVGLGHAYVPATREDYDNSKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARVCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0193243_106066913300019116MarineHGDLYNNIKLMKFFAIAALVASVTASAGTPPTVGLGHAYVPSNREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0193054_107494413300019117MarineHGENILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPANREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193157_102833013300019118MarineMKFALIALIASVSAGTPPTVGLGHGYVPANREDYDNAKELWKADYAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193157_103040113300019118MarineMKFILAFLATVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193157_103053913300019118MarineMKFVIAALIAVVSAGAPPSVGLGHAVIPATREDFDNAKELWKGDWAKYRAGHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193157_103365113300019118MarineMKFAVAALIATVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193157_103381113300019118MarineMKYFAIAALFATVQAGAPPAVGLGHAFIPATREDFDNAKGLWKGDWAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193157_103435013300019118MarineHGDNKLILKIIQMKFVLAALVAAVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193157_103570413300019118MarineHGDNKLILKIIQMKFVLAALVAAVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0193157_103752913300019118MarineMKFAILVAAAYAAAPPSVGLGHAIVPANREDYDNGKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193157_103846913300019118MarineMKYFALAALLAVAKAGTPPAVGLGHAYIPANREDFDNAAEVWKGNWAAYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193256_107881413300019120MarineFPTIIMKFFAIAALFAAVEASAGAPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0192980_107490213300019123MarineHGDNYIYLISIMKFAIVALVAVASAGLPPSAGLGHPIIPATREDFDNAKGVWGGDWAKYRAAHPNDQDCSISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0192980_107752013300019123MarineMKFFAIAALFAAVEAKHHHSHNVEYVALAGTPPTVGLGHAYVPSTREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0192980_108186913300019123MarineWGYNYFIIGKHITMKFTIALLIAAVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0192980_108395713300019123MarineMKIIAIAALLAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0193104_105698413300019125MarineMKFFAIAALLAVEASAGTPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0193436_106349613300019129MarineMKFFAIAALFAVVEAGSPPSVGLGHAVVPATREDYDNAKGLWGGDWAKYRAAHPHDQDCSIAESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0193089_113965113300019133MarineTWGIYNFYNLKHLTMKLLALAALIAVATAGTPPTVGLGHGYVPANREDFDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0188881_1003687713300019146Freshwater LakeMKVIAIAALFALANAGSPPTVGLGHATIPANREDYDNAKELWKGNWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDC
Ga0188870_1011546313300019149Freshwater LakeMKLFALAALFAAAQAGTPPTIGLGHGYVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0188870_1014134623300019149Freshwater LakeMKFAVAALVAIAQAGLPPSAGLGHPIIPATREDFDNAKGVWKGDWASYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0194244_1005463213300019150MarineHGDFWIINILLFPTIIMKLFAIAALFAAVNAGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0194244_1008303313300019150MarineMKFFAIAALLAVEASAGTPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0182064_118000813300019253Salt MarshIMKFILALVATVAAGPAPAVGLGHGIIPATREDFDNAQGVWKGNWASYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0182059_175295513300019272Salt MarshMKFFAFVAAVAARHHEYVALDAAPPTIGLAHGVIPSTREDYDNGKELWKGSWANYRKARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSLDH
Ga0182073_130337413300019274Salt MarshMKFIAIVALFATVEALAPPTVGLGHAVIPANREDYDNGKELWKSNWANYRKARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSVDN
Ga0182075_127305013300019282Salt MarshKFVAALVMAVAAKPHERSFVALAPPTVGLGHAIIPETREDYDNGKELWSSNWAKYRAARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDN
Ga0182075_132099523300019282Salt MarshFTLALIAAVAARHHHEYVGLEANPPTVELSSRFIPRTGEDYDNGKALWANNYAKYRAARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0181562_1032948313300019459Salt MarshMKVIAIAALFALANAGSPPTVGLGHATIPANREDYDNAKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDC
Ga0181554_128993913300020052Salt MarshMKVIAIAALFALANAGNPPTVGLGHGTIPANREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0194113_1046269913300020074Freshwater LakeMKSFALVALFAAVVSAGKPPSVGLGHKYVPATREDYDNAVSLWKGNWAKYRAAHPNDQDCSIRESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0194113_1058035213300020074Freshwater LakeMKFTAIAALLAATVSAGKPPSVGLGHAYIPATREDYDNAASLWKNDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0194113_1111505913300020074Freshwater LakeLAATVYAGKPPSVGLGHAYIPATREDYDNAKSVWGNDWAKYRKAHPHDQDCSIRESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0211732_144249113300020141FreshwaterMKFTAIAALLAATVSAGKPPSVGLGHAYIPATREDYDNAASLWKNDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0211734_1059665013300020159FreshwaterMKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDHXSAKLXNNSGNQVYLKGVKKVQSVIVALINTLKYLS
Ga0206125_1015884513300020165SeawaterMKFILALIATAAAGPAPAVGLGHGIIPATREDFDNSKGVWKGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0206128_118220313300020166SeawaterPVDEILLSNILNFVNILSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0211729_1073480113300020172FreshwaterMKSFALVALFAAVVSAKNPPSVGLGHAHLPATRETYDNAAELWKNNWAKYRAAHPNDQDCSVRESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206124_1024190013300020175SeawaterPIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206124_1036532013300020175SeawaterMVDFNSLIMRIIIIIIIINNLKMKFFALAALLAIAEAGTPPTVGLGHGVVPATREDYDNAKDLWKGSWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADC
Ga0194134_1031195813300020179Freshwater LakeMKSFALVALFAAVVSAGKPPHVGLGHAYVPATRETYDNAAELWKGNWAKYRAAHPNDQDCSIRESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206129_1021532113300020182SeawaterMKFTIIAALVAVAQAGSPPAVGLGHAVIPATREDYDNAKELWKGDWAKYRAAHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0194119_1062863013300020220Freshwater LakeMKSISIIALLAATVYAGKPPRVGLGHAYIPATREDYDNAASIWKNDWAKYRAAHPNDQDCSIRESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0211686_1034923013300020382MarineMKFFAIAALFAAVEASAGTPPTVGLGHAFVPSTREDYDNAKELWKGDWSKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0211708_1041695923300020436MarineAGTPPAVGLGHAYIPATREDYDNGKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0208363_103242013300020503FreshwaterVATVSALEGKPPSVGLGHSVIPATREDYDNAKDLWKGSWAKYRKAHPHDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCQGTPLPDQAPGLTSDC
Ga0208088_102262513300020505FreshwaterMKFFAIAALVATVSALEGKPPSVGLGHSVIPATREDYDNAKDLWKGSWAKYRKAHPHDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCQGTPLPDQAPGLTSDC
Ga0207938_103623413300020525FreshwaterMKFFAIAALVATVSALEGKPPSVGLGHSVIPATREDYDNAKDLWKGSWAKYRKAHPHDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCQGTPLPDQAPGLAHDHXSLNI
Ga0208485_105633613300020573FreshwaterAATVSAGKPPSVGLGHAYIPATREDYDNAASLWKNDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0208053_107342713300020575FreshwaterSAGKPPSVGLGHAYIPATREDYDNAASLWKNDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206126_1032666523300020595SeawaterMKFAIAALVASVSAGLPPSAGLGHPIIPATREDFDNAKGVWTGDWAKYRSAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0214201_102786123300020732FreshwaterMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDHXSAKLXFXKSSEPVYLKGRKKIRSVIVALINTLKYLS
Ga0206677_1018290913300021085SeawaterMKFILALIATAAAGPAPAVGLGHGIIPSTREDFDNSAGVWKGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0194122_1029458413300021092Freshwater LakeMKSFALVALFAAVVSAGKPPHVGLGHAYVPATRETYDNAAELWKGNWAKYRAAHPHDQDCSIRESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0194122_1048041113300021092Freshwater LakeMKSISIFALLAATVYAGKPPSVGLGHAYIPATREDYDNAKSVWGNDWAKYRKAHPHDQDCSIRESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0214162_105067113300021108FreshwaterLLAATVSAGKPPSVGLGHAYIPATREDYDNAASLWKNDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206687_159429413300021169SeawaterFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206687_173180113300021169SeawaterINILLFPTIIMKFFAIAALFAAVEASAGAPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206687_180087113300021169SeawaterLNLFIIILIFDLTIMKFILALIATAAAGPAPAVGLGHGIIPSTREDFDNSAGVWKGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0206696_151369413300021334SeawaterLFPTIIMKFFAIAALFAAVEASAGAPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPD
Ga0206691_115378513300021342SeawaterMKVIAIAALFAAVTARRPHNYQNLAIEAAPPTVGLGHEVIPFNREDYDNGKELWKADWAKYRKARPNEQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLSVDN
Ga0206691_131759313300021342SeawaterMKYFAIAALIAVAKAGTPPAVGLGHAYIPATHEDFDNAAGVWKGNWASYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADC
Ga0206691_137908523300021342SeawaterLIIMKFLTFAALIAATEARRPFDYQNLNIEAAPPTVGLGHEVIPWNREEYDNGKTLWAGNWSKYRAARPNDQDCGISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLALDN
Ga0206691_143127113300021342SeawaterFIMKFVALALIAAVEARHHHHEMVELNARPANLGLASGYIPWNREDYDNGKTLWAGDYKKYRTARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERAGWCSGYDGCEGTPLPDHAPGLSQDH
Ga0206691_151674613300021342SeawaterMKFVIAALVAAVSAGTPPTIGLGHAWIPANREDYDNGKELWKGDWAKYRAGHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206691_168295213300021342SeawaterSTQKIMKYFALAALIAAAKAGTPPAVGLGHAYIPATREDYDNAGALWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0206691_169431113300021342SeawaterMKFVLAALIASANAGTPPTVGLGHGFIPANREDYDNGKELWKGDWAKYRAGHPHDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0206691_177176013300021342SeawaterKFLTFAALIAATEARRPFDYQNINIEAAPPTVGLGHEIIPMNREEYDNGKTLWSGNWAKYRAARPNDQDCGISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLALDN
Ga0206688_1024372513300021345SeawaterMKYFALAALIAFAKAGTPPAVGLGHAYIPANREDYDNASALWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206688_1033605713300021345SeawaterTYQIKMKFAFALIAAINAATPPTVGLGHAWIPSNRESYDNGKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0206688_1070814013300021345SeawaterDLIIMKFLTFAALIAATEARRPFDYQNLNIEAAPPTVGLGHEVIPFNREEYDNGKELWSGNWAKYRAARPNDQDCGISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADN
Ga0206688_1080837813300021345SeawaterTMKFLAAALLGLVSAGTPPSVGLGHALIPANREDFDNAKDLWKNDWAKYRAAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0206695_101552913300021348SeawaterLIIMKFLTFAALIAATEARRPFDYQNINIEAAPPTVGLGHEIIPMNREEYDNGKTLWSGNWAKYRAARPNDQDCGISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADN
Ga0206695_133436113300021348SeawaterTMKLFALAALFAAANAGTPPTVGLGHGYIPANREDYDHAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0206695_141354723300021348SeawaterMKFFALAALIATAAAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0206695_149044613300021348SeawaterKVYLPETIIINILFIMKFIAALALIASVEARHHHHEMVELQARPANLGLASGYIPWNREDYDNGKTLWANDYKKYRAARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERAGWCSGYDGCEGTPLPDQAPGLSQDH
Ga0206695_150068213300021348SeawaterLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPD
Ga0206695_155155413300021348SeawaterMKYFALAALIAFAKAGTPPAVGLGHAYIPANREDYDNASALWGGDWAKYRAAHPNDQDCGISESDSWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206695_178308513300021348SeawaterMKLLALAALIAVATAGTPPTVGLGHGYVPANREDFDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0206692_127278313300021350SeawaterFFALIAAVAAQPSVGLASAYIPATREDYANSDELWGGNWGDYRKARPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH
Ga0206692_147070713300021350SeawaterIINILLFPTIIMKFFAIAALFAAVEASAGAPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206693_133452813300021353SeawaterKHITMKFFALAALIAAANAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0206693_146077813300021353SeawaterNILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206693_165670513300021353SeawaterMKLFALAALFAAVNAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0206690_1019239813300021355SeawaterIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPANREDYDNAKELWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206690_1025579713300021355SeawaterKFVFAALIATASALRGAPPAVGLGHAFIPATREDFDNAKGLWKGDWAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSQTIELIEAS
Ga0206690_1034625313300021355SeawaterLTIMKFILALIATAAAGPAPAVGLGHGIIPSTREDFDNSAGVWKGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0206689_1090181813300021359SeawaterFQPIIMKYFALAALLAVAKAGTPPAVGLGHAYVPATREDYDNASALWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206689_1104174013300021359SeawaterIMKFLTFAALIAATEARRPFDYQNLNIEAAPPTVGLGHEVIPWNREEYDNGKTLWAGNWSKYRAARPNDQDCGISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLALDN
Ga0206689_1104243313300021359SeawaterIMKFLTFAALIAATEARRPFDYQNLNIEAAPPTVGLGHEVIPFNREEYDNGKELWSGNWAKYRAARPNDQDCGISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADN
Ga0206689_1111327913300021359SeawaterMKFLAIAALFAAVDARPHNYQNIEIEAKPPTVGLGHSIIPENREDYDNGKTLWKGDWAKYRAGHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADC
Ga0206123_1019244423300021365SeawaterMKFILALIATAAAGPAPAVGLGHGIIPSTREDFDNAQGVWKGNWAGYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0206123_1026416413300021365SeawaterMKFAIAAIIATVSAGLPPSAGLGHPIIPATREDFDNAKGVWTGDWAKYRSAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0213860_1018872613300021368SeawaterMKFILALVATVAAGPAPAVGLGHGIIPATREDFDNAQGVWKGNWASYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0194130_1045806013300021376Freshwater LakeMKSISIIALLAATVYAGKPPRVGLGHAYIPATREDYDNAASIWKNDWAKYRAAHPNDQDCSIRESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCQGTPLPDQAPGLAPDH
Ga0063107_10438313300021869MarineLINMQIALIALIASVSAGTPPTVGLGHGFVPANREDYDNAKELWKGDFAKYRAGHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0063089_100483913300021889MarinePTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0063137_100014113300021892MarineFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0063136_100003813300021896MarineFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0063086_100860513300021902MarineIYNFYNLKHLTMKLLALAALIAVATAGTPPTVGLGHGYVPANREDFDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0063096_100159613300021925MarineKLINMQIALIALIASVSAGTPPTVGLGHGFVPANREDYDNAKELWKGDFAKYRAGHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0063096_101960113300021925MarineTMKFILAALVAAVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0063103_100548513300021927MarineLFPTVIMKIFAIASLFAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0063134_102217413300021928MarineMKFALIALIAAVQATTTQMPAPTVGLGHSVIPATMEEYDNGKELWTGDWKKYRAARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSLDH
Ga0063102_104939013300021941MarineMKFIAIALFAVVSARRPHNYINLAIDAPAPTVGLGSAQIPANSETYDNGKELWKADWAAYRKARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDN
Ga0063101_102787113300021950MarineFPTVIMKIFAIASLFAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0222717_1029587913300021957Estuarine WaterMKYFALAALIAAASAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0222717_1033298913300021957Estuarine WaterMKFILALIATAAAGPAPAVGLGHGIIPSTREDFDNSQGVWKGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0222718_1040237313300021958Estuarine WaterALIAAVAARHHHEYVGLESNPPTVGLSSRFIPRTAEDYDNGKTLWANNYAKYRAARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0222715_1057003213300021960Estuarine WaterMKFYALAALIAAANAGTPPTVGLGHGYIPATREDYDNAKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADC
Ga0222715_1069011213300021960Estuarine WaterMKFAIAALVASVSAGLPPSAGLGHPIIPATREDFDNAKGVWKGDWAAYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0222713_1017901813300021962Estuarine WaterMKFTLALIAAVAARHHHEYVGLEANPPTVGLSSRFIPRTKEDYDNGKQLWGNNYAKYRAARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPD
Ga0222713_1046825313300021962Estuarine WaterMKFFAYAALIATTSAVEGAPPTVGLGHAIIPATREDYDNAKELWKGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0222712_1033240213300021963Estuarine WaterMKLFALVALFAAVEAGTPPTVGLGHAYIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0222719_1080290713300021964Estuarine WaterAARHHHEYVGLEANPPTVGLSSRFIPRTAEDYDNGKTLWANNYAKYRAARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0214917_1020866913300022752FreshwaterPKTPKPLKYEININLLIKFEIIKKSLIYFYYNIYYTNNQKMKVFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNDWAKYRRAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0222647_106310913300022827Saline WaterMKFFAIAAFVAVTEARHSHEFVALEARPPTLGLAHPIIPATTEDYDNGKELWKGDWAAYRRGRPNDQDCSLSESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0222706_102624023300022829Saline WaterPIIPATTEDYDNGKELWKGDWAAYRRGRPNDQDCSLSESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0255756_117356623300022905Salt MarshMKFFALAALLAIAEAGTPPTVGLGHGVVPATREDYDNVKDLWKGSWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDC
Ga0255752_1026904023300022929Salt MarshMKLFAIAALFAAVNAGTPPTVGLGHSVVPSTREDYDNAKDLWKGSWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDC
(restricted) Ga0233406_1006885613300023085SeawaterGSPPTVGLGHAVIPANREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0214921_1033949613300023174FreshwaterMKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNASSLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDHXSAKLX
Ga0214923_1035855213300023179FreshwaterMKFTAIAALLAATVSAGKPPSVGLGHAYIPATREDYDNAAALWKNDWAKYRAAHPNDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0214923_1043844913300023179FreshwaterLLKIKIMKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0228679_102058413300023566SeawaterIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0228686_103053713300023685SeawaterNILNFVNILSIINILLFPTIIMKFFAIAALFAAVEASAGAPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0228687_103132013300023696SeawaterGLTILIYNYIYSISIMKFAVAALIAIAQAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
(restricted) Ga0233439_1025957323300024261SeawaterMKFAIAALVALTTAGRPPAIGLGHPIIPANREDFDNAKGVWKGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0228656_107668213300024322SeawaterMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0244777_1042783423300024343EstuarineMKFSTITALVATVAARHHNHELVEVSAAPPTVGLGHSVIPTNREDYDNGATLWKKDWKAYRGAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSMDH
Ga0244777_1046335613300024343EstuarineMKFLAIAALFAAVEARPHNYENLEIEAKPPTVGLGHAIIPENREDYDNGATLWKNDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDC
Ga0209634_117781813300025138MarineMKLIYNYIIFDLIIMKFLALALLGAVSAGAPPSVGLGHGVIPSTREDFDNAAGVWKGDWAAYRAARPHDQDCSIAESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLASDC
Ga0208384_10982113300025328FreshwaterSKHNKMKLFALAALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0208866_100469213300025340FreshwaterYYSKHNKMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0208108_101411813300025367FreshwaterMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0208382_104181513300025369FreshwaterSKHNKMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0207959_102609913300025387FreshwaterMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDHAPGLSPDHXSAKLXFXKSSEPVYLKGRKKIRSVIVALINTLKYLS
Ga0208249_112553113300025532FreshwaterYSKHNKMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0208660_104214813300025570AqueousAGPSPPAVGLGHETIPWNREVYDNAKELWAGDWAKYRSAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSQDH
Ga0208660_106839323300025570AqueousMKFALIALVAIAQAGTPPSSGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0208660_108935413300025570AqueousMKFAIIALVAVAAAGTPPSSGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0208864_112645513300025578FreshwaterNKYYSKHNKMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0209716_111234113300025626Pelagic MarineMKFAVIALVAIAQAGTPPSSGLGHPIIPATREDFDNAKGVWTGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0209306_110329513300025680Pelagic MarineMKFSAIAALFAATVSAGSPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0209095_112731923300025685Pelagic MarineMKSFVLAAIAAVVSAGAPPTVGLGHAVIPQTREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0209715_119314413300025699Pelagic MarineMKFFAIAALIATATASAGTPPTVGLGHAYIPATKEDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0209602_113485213300025704Pelagic MarineMKFTTIALVAVVSAGTPPSSGLGHPIVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADCXSSSQFV
Ga0209305_113993413300025712Pelagic MarineMSRIPLIYNYFLIIMKFSVIAALVATVSAGSPPAVGLGHAVIPATREDYDNAKELWKGDWAKYRAAHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0208784_104323423300025732AqueousMKIAFLLAVVSARHHELVELAPPTQGLTSPTIPKTREDYDNGQALWGGDYRKYRASRPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0208784_113887413300025732AqueousMKYTIIAAIVAATSALEPPTVGLGHPNIPLNREDYDNGKELWGSNWAKYRAARPNDQDCGISESDNWKGAQQCSQNWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSVDN
Ga0209603_130179613300025849Pelagic MarineMKFFALAALIATASAGTPPTVGLGHAYVPSTREDYDNSKELWKGDWAKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARVCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0209308_1009250513300025869Pelagic MarineMRFFAIAALIATVTAEAGTPPTVGLGHSYIPATKEDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0209308_1025778013300025869Pelagic MarineMKLFAIAALFAAVNAGTPPTVGLGHSVVPATREDYDNAKDLWKGSWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADC
Ga0209533_122991413300025874Pelagic MarineMKFALIALVAIAQAGTPPSSGLGHPIIPATREDFDNAKGVWTGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0209555_1019598023300025879MarineMKFFAIAALIAAANAGSPPTVGLGHGTVPATREDYDNAKELWKGNWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADC
Ga0209534_1020744813300025880Pelagic MarineMKVFALAAIFATTQAAPAPTVGLGHAVIPPNREEYDNGKELWKANWAAYRNSRPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGL
Ga0208544_1009092023300025887AqueousMKFSAVTMLVALVGAKHHHQQFVEVDAPAPTVGLGHSVIPATSETYDNGKTLWKADWKAYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSNDH
Ga0208544_1027255513300025887AqueousMKFTSFAALVAVVAAAAPPTVGLGHNVIPANREDYDNGAALWKNDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSMDH
Ga0209631_1012242223300025890Pelagic MarineMKFSIVALVATVAARHHHAEYVQTFAAPPTVGLSNNNIPANREDYDNGKTLWAANYAKYRAARPNDQDCSISESDNWVGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0209630_1049126613300025892Pelagic MarineMKFVLIALVATVSAGLPPSAGLGHPIIPATREDFDNAKGVWTGDWAKYRSAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0209335_1023169923300025894Pelagic MarineMKSFVLAAIAAVVSAGAPPTVGLGHAVVPQTREDYDNGKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0209961_105714823300026130WaterMRSLKIFIVDDSFQLLIIIYNPIIMKYFAFAALIAAAQAGTPPTVGLGHQYIPATREDYDNAQSLWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADC
Ga0208763_103044413300026136MarineMKFFAIAALFAMEVSAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0208763_104244913300026136MarineMKYFALAALLAVAQAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADC
Ga0208276_103544713300026166MarineMKFVLALIATVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0208275_101431813300026182MarineMKLIALTALIATVSAGAPPAVGLGHAFIPATREDFDNAKGLWKGDWAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0208275_106969713300026182MarineMKFFAIAALFAAVEASAGTPPSVGLGHAYIPANREDYDNAKELWAGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0208275_110882313300026182MarineMKFAFALIAAVNAASPPAVGLGHAFVPATREDFDNGKELWKGDWAKYRSSHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0208405_102784213300026189MarineMKFFAIAALAAAVEASAGTPPAVGLGHAYVPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0209913_108305713300026272SoilMKLYALIALFAAVEAGTPPTVGLGHAFVPANREDYDNAASLWKGSWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDHXSAKLX
Ga0247581_108456013300026420SeawaterILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0247559_113123613300026443SeawaterAMFADVEVSAGSPPTVGLGHAVIPANREDYDNAKELWKGAWASYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0247594_104301113300026448SeawaterLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPD
Ga0247593_110736413300026449SeawaterSIMKFTLIALVATVAAGTPPSAGLGHPIIPATREDFDNAKGVWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0247593_112315313300026449SeawaterKFFAIAALFAAVEASAGSPPTVGLGHAIIPANREDYDNAKELWKGDWASYRTAHPNDQDCSISESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGFPLPTQAPGVSYTH
Ga0247600_108090013300026461SeawaterKFFAIAALFGLASAGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0247588_106975713300026465SeawaterILLFPTIIMKFFAIAALFAAVEASAGAPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0247588_110922313300026465SeawaterMKFFAIAAMFAAVEVSAGSPPTVGLGHAIIPANREDYDNAKELWKGDWASYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH
Ga0247588_112087013300026465SeawaterMKYFAIAALIAAAKAGTPPAVGLGHAYIPANREDYDNGAELWKGNWATYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDC
Ga0247598_113117513300026466SeawaterIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0247603_113275013300026468SeawaterIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0247599_107651713300026470SeawaterNILSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0228641_110588113300026491SeawaterMKFTIIALVATASAGLPPSAGLGHPIVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0247571_112904213300026495SeawaterYIPQTREDYDNAKELWAGNWGDYRKARPHDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAPDH
Ga0247592_113109913300026500SeawaterKFFFIIIFSTNIMKFFAIAAMFAAVEVSAGSPPTVGLGHAIIPANREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0247605_113646913300026503SeawaterLIAAVAAQPSVGLASAYIPATREDYANSDELWGGNWGDYRKARPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH
Ga0247605_115768613300026503SeawaterYCSIMKFTLIALVATVAAGTPPSAGLGHPIIPATREDFDNAKGVWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0247605_116958713300026503SeawaterDKMKFAIAALVASVSAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0247590_116004213300026513SeawaterNIMKFFAIAAMFAAVEVSAGSPPTVGLGHAIIPANREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0247590_118969213300026513SeawaterFALIAAVAAQPSVGLASAYIPATREDYANSDELWGGNWGDYRKARPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH
Ga0208675_101982913300027189EstuarineMKFLAIAALFAAVEARPHNYENLEIEAKPPTVGLGHAIIPENREDYDNGATLWKNDWAKYRAAHPNDQDCSISESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0208021_105793113300027191EstuarineIMKFAVAALIATVSAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0208928_105699713300027217EstuarineSDEKKGKKYNPPSVGLGHKWIPATREDYNNAKDLWKGDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDC
Ga0208930_104862113300027237EstuarineEKKGGKKYNPPSVGLGHKWIPATREDYNNAKDLWKGDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDC
Ga0208796_105920123300027308EstuarineMKFAVAALIAIAQAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0208923_104604313300027320EstuarineMKFIAVAALFAAVDAATPPTVGLGHSIVPETREDYDNGATLWKKDWAGYRGAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATDC
Ga0208556_109685513300027366EstuarineMKFVVIAALFAVIHADEDSDEKKGKKYNPPSVGLGHKWIPATREDYNNAKDLWKGDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDC
Ga0208897_111072713300027571EstuarineINMKSFVLAAIAAVVSAGAPPTVGLGHAVIPQTREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0208966_108288913300027586Freshwater LenticMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNASSLWKSNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0209188_118462013300027708Freshwater LakeTKTPKPLKYEININLLIKFEIIKKSLIYFYYNIYYTNNQKMKVFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKNDWAKYRRAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0209188_118707913300027708Freshwater LakeMKLFALVALFAAVEAGTPPTVGLGHAFIPANREDYDNAKSLWKGDWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0209188_120506413300027708Freshwater LakeMRFIAIVALFAATAQAGNPPPTVGLGHAYIPATRESYDNAKELWGNNWKQYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCKGTPLPDQAPGLAPDH
Ga0208305_1024124613300027753EstuarineMKFTILALVATVAAGTPPAAGLGHPIIPATREDFDNAKGVWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0209296_123432713300027759Freshwater LakeMKFTAIAALLAATVSAGKPPSVGLGHAFVPATREDYDNAAALWKNDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0209086_1033602913300027770Freshwater LakeMKFTAIAALLAATVSAGKPPSVGLGHAYVPATREDYDNAAALWKNDWAKYRAAHPNDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0209091_1023661713300027801MarineMKIFAIASLFAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0209229_1035467713300027805Freshwater And SedimentAGKPPSVGLGHAYIPATREDYDNAASLWKNDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0209302_1019443823300027810MarineMKLFALAALVAAANAGTPPTVGLGHGFVPANREDYDNAKELWKGDFAKYRAGHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0209302_1020244613300027810MarineMKFTLIALIAAVNAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAGHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0209302_1041126413300027810MarineLSNILNFVNILSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0209302_1043506213300027810MarineMKFAIAAIVATVSAGLPPSAGLGHPIIPATREDFDNAKGVWTGDWAKYRSAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLASDC
Ga0209092_1008625723300027833MarineMAAVSAGTPPTVGLGHGYVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDCXSATDFMNEATEDC
Ga0209092_1027401713300027833MarineMKTFAIAALLAAVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0209092_1037851313300027833MarineMKFTIIALVATASAGLPPSAGLGHPIVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0209092_1038213623300027833MarineMERYIFIYYFGLTILIYNYIYTISIMKFAVAALVAIAQAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0209092_1045342213300027833MarineMKFFAIAALAAAVEASAGTPPAVGLGHAYVPATREDYDNGKELWAGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0209230_1081251813300027836Freshwater And SedimentFSTIIMKFFAIAALVATVSALEGKPPSVGLGHAVIPATREDYDNAKDLWKGSWAKYRKAHPHDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCQGTPLPDQAPGLTSDC
Ga0209712_1041944113300027849MarineMKFTIIALVATASAGLPPSAGLGHPIVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0209712_1044682113300027849MarineMKFAIVALVAIAQAGTPPSSGLGHPIIPATREDFDNAKGVWKGDWAAYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0209713_1050008613300027883MarineMKFAIVALVASVSAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0209713_1056456613300027883MarineMKFTIIALVATVSAGLPPSAGLGHPIVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0209668_1042724913300027899Freshwater Lake SedimentMKSFAILALFAATVSAGKPPSVGLGHAYVPATREQYDNSVELWKNSWAKYRAAHPNDQDCSVRESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0209668_1056317513300027899Freshwater Lake SedimentMKFTAIAALLAATVSAGKPPSVGLGHAYIPATREDYDNAATLWKNDWAKYRAAHPNDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0209668_1079021913300027899Freshwater Lake SedimentMDDLLKSLIYYFLINIILNKIKMKLFALIALFAAVEAGTPPTVGLGHAFIPGNREDYDNASSLWKSNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDHX
Ga0209048_1108952913300027902Freshwater Lake SedimentMDDLLKSLIYYFLINIILNKIKMKLFALIALFAAVEAGTPPTVGLGHAFIPGNREDYDNASSLWKSNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0209191_119524923300027969Freshwater LakeMKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNAASLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDHXSAKLX
Ga0209299_117049613300027974Freshwater LakeMKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNASSLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDHXSGKLX
Ga0209284_1011487233300027983FreshwaterMKFVTFVALIATASARHHHNTEFVDISAAPPTVGLGHSKIPSNREDYDNGAALWKNNWASYRAARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSADH
(restricted) Ga0255057_1023504013300027997SeawaterMKAKFYNYIIFQQIIMKSFAIAMIAAVVSAGAPPTVGLGHAIIPANREDYDNAKDLWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0247586_106237513300028102SeawaterINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0247596_111001313300028106SeawaterITMKLFALAALFAAAQAGTPPTIGLGHGYVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0247582_120246713300028109SeawaterCSIMKFTLIALVATVAAGTPPSAGLGHPIIPATREDFDNAKGVWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCVGTPLPNQAPGLAADC
Ga0247584_111193113300028110SeawaterLLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0247584_115594213300028110SeawaterKFTLIALVATVAAGTPPSAGLGHPIIPATREDFDNAKGVWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0247584_116338913300028110SeawaterKMKFTILALVATVAAGTPPAAGLGHPIIPATREDFDNAKGVWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0256412_125537313300028137SeawaterMKFTALAALLATASAGAPPTVGLGHQYVPATREDYDNSKELWKGDWAKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARVCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0256412_131583113300028137SeawaterMAEILLSNILNFVNILSIINILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0256412_132612213300028137SeawaterKMKFTIIALVATASAGLPPSAGLGHPIVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0256412_133115213300028137SeawaterFALAALIATTSATAGSPPTVGLGHAIIPANREDYDNAKELWKGDWAKYRTAHPNDQDCSISEPDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0256412_140110713300028137SeawaterKFTAFVALIATVEARNHEYVSLDAAPPTIGLAHAVIPSTREDYDNGKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPD
Ga0256417_122413413300028233SeawaterVLLLHITMKLFALAALFAAAQAGTPPTIGLGHGYVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0228613_110837013300028279SeawaterVATRVIKMKFTIIALVATASAGLPPSAGLGHPIVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0256413_122523713300028282SeawaterKFFAIAALAAAVEASAGTPPAVGLGHAYVPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0256413_126173113300028282SeawaterTILIYNYIYSISIMKFAVAALIAIAQAGLPPSAGLGHPIIPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0256413_136718913300028282SeawaterKFFAIAALFAAVEARHHHHPQNVEAVQIAGTPPKVGLGHAVIPATREDFDNASGVWGGDWAKYRAAHPHDQDCSISESDNFKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADC
Ga0247572_119304213300028290SeawaterLIAAVAAQPSVGLASAYIPATREEYANSDELWGGNWGDYRKARPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH
Ga0247572_120233113300028290SeawaterIIMKFFAIAALFAAVEASAGAPPAVGLGHAYIPATREDYDNAKELWGADWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0247566_106959913300028335SeawaterLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYVPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPD
Ga0247566_109516913300028335SeawaterLINTKMKFTIIALVATASAGLPPSAGLGHPIVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0247566_109756713300028335SeawaterKFILALIATAAAGPAPAVGLGHGIIPSTREDFDNSAGVWKGDWAKYRAAHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0247579_112129413300028337SeawaterTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNGKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0304728_122242313300028393Freshwater LakeMKLYALIALFAAVEAGTPPTVGLGHAFIPANREDYDNASSLWKGNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0306910_103441013300028412Saline LakeMKLFAIAALFAAVDAATPPTIGLGHSVIPMNREEYDNGAELWKNDWAAYRRSRPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSADN
Ga0304731_1101413713300028575MarineVGLGHAYIPANREDYDNASALWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0304731_1101413723300028575MarineAAAKAGTPPAVGLGHAYIPATREDYDNAGALWGGDWAKYRAGHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0304731_1153782313300028575MarineNIMKSFVLAALAALASAGTPPTVGLGHAFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0272440_116527413300028595Marine SedimentMKFIAIVAALAATEVSAGAPPAVGLGHAIIPANREDYDNAKELWKNDWAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLTPDH
Ga0307403_1058342913300030671MarineITMKYFALAALIAAANAGTPPTVGLGHGYVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0307403_1083263713300030671MarineITMKFTIALLIAAVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0307398_1013107213300030699MarineMKFAIVALVATVAARHHHHEYVALDARPPTVGLASGYIPHTKEDYDNGKTLWAANYKKYRAARPNDQDCSISESDNWMGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0307398_1080704013300030699MarineKHITMKFTLIALIAAVNAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0307398_1084396513300030699MarineLQMKSFILAALVAAASAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRSGHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0307399_1054752813300030702MarineTMKLFALAALFAAVQAGTPPTIGLGHGYVPANREDYDNAKELWKGDFAKYRAGHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0308127_104989213300030715MarinePTVIMKIFAIASLFAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0308139_107988513300030720MarineFILAALVAAVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0308129_102492323300030723MarineKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0073988_1228741613300030780MarineFEMSQQDFTQARRGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0073981_1000858513300030857MarineAALFAAVEASAGTPPAVGLGHAYIPANREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0073984_1128891823300031004MarineMKFIAALLAFAAAGAPPSVGLGHAYIPATREDFDNAKELWKNDWAKYRAAHPHDQDCSISESDSWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0073980_1000661513300031032MarinePTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0073978_102277913300031036MarineMKFTIALIAAINAATPPTVGLGHAWIPANRESYDNGKELWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0073986_1178663213300031038MarineLEFVLSQQDYTQARRGTPPAVGLGHAYVPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0073989_1001370813300031062MarineKYAFAALIAVVAAQPSVGLASAYIPQTREDYDNAKELWAGNWGDYRKARPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0073989_1347539913300031062MarineMKFFAIAALFAAAEARKHHHHNYEYVSLAGTPPTVGLGHAYVPATREDYDNAKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0307980_106020513300031216Saline WaterMKLFAIAALFAAVDAATPPTVGLGHSVIPMNREEYDNGAELWKNDWAAYRRSRPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSADN
Ga0307971_115399323300031382Saline WaterPTIGLGHSVIPMNREEYDNGAELWKNDWAAYRRSRPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSADN
Ga0307388_1126586713300031522MarineIYLMKFAVAALIATVSAGTPPTVGLGHGYVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0308148_104023813300031557MarineLLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0307489_1014366113300031569Sackhole BrineMKFLTFVALIAAASAKHHQHSLVEVTATPPTVGLGHNVVPENREEYDNGATLWKNDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLSGDH
Ga0307489_1015640733300031569Sackhole BrineMKFFAIAALIAATSASAGTPPTVGLGHSIVPANREDYDNAAELWKGDWSKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0307489_1044176013300031569Sackhole BrineMKFVLVALIAAVEARHHHHNDASFVELAGTPPTVGLGHAIIPANREDYDNAKDLWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLVPDF
Ga0308134_109811113300031579MarineTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0308134_113570913300031579MarineMKYFALAALIASAAAGTPPTVGLGHGYVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0308134_116482813300031579MarineRFSVIAALVATVSAGTPPAVGLGHAVIPATREEHDNAKELWKGDWAKYRASHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0308134_116637713300031579MarineVIMKIFAIASLFAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0308132_111552413300031580MarineKFVLAALIAAVSAGTPPTVGLGHGFVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0307996_111871113300031589MarineMKFTAIAALVATVSAGSPPAVGLGHAVIPANREDYDNGKELWKGDWAKYRAGHPADQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0302131_113780613300031594MarineMKFAVAALVAIAQAGLPPSAGLGHPIIPATREDFDNAKGVWKGDWASYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0302114_1032620113300031621MarineMKSFVLAAIAAVVSAGAPPTVGLGHAVVPQTREDFDNGKELWKGDWAKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLSPDH
Ga0302114_1032816713300031621MarineMKFFAIAALIATVTAEAGTPPTVGLGHSYVPSNREDYDNAKELWKGDWAKYRTSHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAADH
Ga0302114_1034297113300031621MarineMKLFALAALFAAVQAGTPPTIGLGHGYVPANREDYDNAKELWKGDFAKYRGAHPHDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0302114_1037147213300031621MarineMKFTAIALVAAVSAGTPPSSGLGHPIVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0302126_1019166313300031622MarineMKFTIIALVATVSAGLPPSAGLGHPIVPATREDFDNAKGVWKGDWASYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0302121_1007059713300031626MarineMKFTLIALIGAVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0302121_1014214423300031626MarineMKFAIVALVATVAAGLPPSAGLGHPIIPATREDFDNAKGVWKGDWASYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0307385_1041811413300031709MarineMKFIAAAILGLVSAGSPPSVGLGHALIPANREDFDNAKDLWKADWAKYRSAHPHDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0307386_1075427213300031710MarineMKFAVAALIATVSAGTPPTVGLGHGYVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0307381_1020559223300031725MarineLFPTVIMKIFAIAALLAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0307381_1040952413300031725MarineIIMKSFILAALIAVASAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAGHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWFSVYDGCEGTPLPDQAPGLLPDC
Ga0307391_1088565013300031729MarineKHITMKFILAALVAAVSAGTPPTVGLGHGYIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0307397_1046181913300031734MarineYIMKFILVALVATAAAAAPPAVGLGHGIIPATREDFDNSSGVWKGDWAKYRAGHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0307394_1047382013300031735MarineFTIALLIAAVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0307394_1047410013300031735MarinePMKFIIAALVAVSARPVDNQFVAMAPPTVGLGHEIVPANREDYDNGKELWAANWKKYRAARPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLATD
Ga0307383_1047493413300031739MarineMKLFAIAALFAAAQAGTPPTVGLGHGYVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0307383_1054130013300031739MarineLTIMKFILALLATVAAGPAPAVGLGHGIIPATREDFDNSAGVWKGDWAKYRAGHPNDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLATDC
Ga0307383_1071395213300031739MarineMKYFALAALVAIASAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAGHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0307383_1073415313300031739MarineFILAALVATVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0307395_1038247213300031742MarineKSFILAALVAAASAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRSGHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0315899_1072045013300031784FreshwaterMKSFALVALFAAVVSAGKPPSVGLGHAFVPATREKYDNAAELWKNNWAKYRAAHPNDQDCSVRESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0315330_1038308913300032047SeawaterMKFVIAALLGAVSAGSPPAVGLGHAYIPATREDYDNAHELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0315305_115105313300032127MarineITMKFILAALVATVSAGTPPTVGLGHGFIPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDC
Ga0314779_103425913300032150SedimentLMKVIALVAIFAAVEARRPHNYENISLTATPPTIGLGHPVIPFNREDFDNGTTLWKANWSTYRKAHPNEQDCSISESDNWKGAQQCSQSFECRGARVCERGGWCSGYDGCEGTPLPDQAPGLATDN
Ga0315271_1090008513300032256SedimentMKFTAIAALLAATVSAGKPPSVGLGHAFIPATREDYDNAAALWKNDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0335396_1026872913300032462FreshwaterMKFITFVAIIASVSAKHHYNTEFVDISAAPPTVGLGHSKIPSNREDYDNGAALWKNNWASYRAARPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSADHX
Ga0314676_1015013023300032519SeawaterLTIIMKFFAIAALFAAVEAKHHHSHNVEYVALAGTPPTVGLGHAYVPSTREDYDNAKELWKGDWASYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0314676_1073401523300032519SeawaterFFALIAAVAAQPSVGLASAYIPATREDYSNADELWGGKWADYRTARPHDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH
Ga0314680_1070012023300032521SeawaterMLLTHECYPAPINSFAIIALLYCQKFFAIAALAAAVEASAGTPPAVGLGHAYVPATREDYDNGKELWAGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0314677_1048242723300032522SeawaterFPTVIMKIIAIASLFAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0314682_1074468213300032540SeawaterLKFYRITVEISQPSVGLASAYIPATREDYANSDELWGGNWGDYRKARPHDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH
Ga0314674_1065947813300032615SeawaterKYTKMKFTTIALVAVVSAGTPPSSGLGHPTVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0314671_1031770413300032616SeawaterMKFFAIAALLAATASAGSPPTVGLGHAYVPSTREDYDNAKELWKGDWSKYRTAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDF
Ga0314671_1057170113300032616SeawaterVSNFRFFPKDRRMALMQLGTVEEAIISLIKLHNKKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0314671_1062789613300032616SeawaterLKYTKMKFTTIALVAVVSAGTPPSSGLGHPTVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0314673_1068501013300032650SeawaterFALIAAVAAQPSVGLASAYIPATREDYANSDELWGGNWGDYRKARPHDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCTGYDGCEGTPLPDQAPGLAADH
Ga0314687_1048008913300032707SeawaterILLFPTIIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0314669_1046351613300032708SeawaterLFPTVIMKIIAIASLFAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0314695_137071213300032724SeawaterYTKMKFTTIALVAVVSAGIPPSSGLGHPIVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0314693_1042365713300032727SeawaterMDCLHLARNSLSFGQVFICLCLWLYFLFKCKCSSQIMKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0314714_1043715113300032733SeawaterQPCGKPPEKPVPTVIMKIIAIASLFAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0314706_1062289413300032734SeawaterETVKTNFNERSEVKFFAIAALFAAVEASAGTPPAVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDAWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0314712_1060328513300032747SeawaterMKFTLAALIAAVSAGSPPAVGLGHAYIPATREDYDNAKELWKSNWAKYREAHPHDQDCSISESDSWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0314691_1043380513300032749SeawaterSIINILLFPTIIMKFFAIAALAAAVEASAGTPPAVGLGHAYVPATREDYDNGKELWAGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0314700_1064482323300032752SeawaterKMKFTTIALVAVVSAGTPPSSGLGHPTVPATREDFDNAKGVWAGDWAKYRSAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0314709_1046479013300032755SeawaterLSDYTKGTKMDYDVEIWGNSVHAFSIKYSDAFNQVAIASLFAAVQAGSPPSVGLGHAYIPATREDYDNAKELWGGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0310342_10121326413300032820SeawaterMKFFAIAALFAAVEASAGTPPSVGLGHAYIPATREDYDNARELWAGDWAKYRAAHPNDQDCGISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0310342_10126778213300032820SeawaterPKPQNPNYMNYEPQSNSLKFYCLYKCSRHNLFYNYIIFDLIIMKFLALIATAYAAAPPAVGLGHGVIPSTREDFDNAAGVWKSDWAAYRGAHSHDQDCSVSESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLQNQAPGLANDC
Ga0310342_10274889813300032820SeawaterHITMKLFAVAALCAFAQAGTPPTVGLGHGYVPANREDYDNAKELWKGDFAKYRAAHPHDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0307390_1104298113300033572MarineMKFAIAALVAVASAGLPPSAGLGHPIVPATREDFDNAKGVWAGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARMCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0307390_1104404113300033572MarineIIMKFTAFAALVAGVSAAPAVGLGHAIIPATREDYDNGKELWKGDWAKYRAAHPNDQDCSISESDSWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLLPDH
Ga0334989_0631270_101_4603300033984FreshwaterMDDLLKSLIYYFLINIILNKIKMKLFALIALFAAVEAGTPPTVGLGHAFIPGNREDYDNASSLWKSNWAKYRKAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGC
Ga0334983_0586278_317_6103300034060FreshwaterKPPSVGLGHAYIPATREDYDNAASLWKNDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.