NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016882

3300016882: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with 33 psu seawater, 19 C, 33 psu salinity and 331 ?mol photons light - Strombidium rassoulzadegani ras09 (MMETSP0449_2)



Overview

Basic Information
IMG/M Taxon OID3300016882 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0128947 | Gp0212289 | Ga0186577
Sample NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with 33 psu seawater, 19 C, 33 psu salinity and 331 ?mol photons light - Strombidium rassoulzadegani ras09 (MMETSP0449_2)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size13529730
Sequencing Scaffolds21
Novel Protein Genes26
Associated Families25

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani7
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Sapindaceae → Hippocastanoideae → Acereae → Acer → Acer yangbiense1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea7
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum3
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine tidal flow zone → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)41.0Long. (o)-72.0Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000055Metagenome / Metatranscriptome3096Y
F000075Metagenome / Metatranscriptome2622Y
F000787Metagenome / Metatranscriptome891Y
F000935Metagenome / Metatranscriptome828Y
F001461Metagenome / Metatranscriptome690Y
F009426Metagenome / Metatranscriptome318Y
F011523Metagenome / Metatranscriptome290Y
F011815Metagenome / Metatranscriptome287Y
F012918Metagenome / Metatranscriptome276Y
F015263Metagenome / Metatranscriptome256Y
F018935Metagenome / Metatranscriptome232Y
F019022Metagenome / Metatranscriptome232Y
F024569Metagenome / Metatranscriptome205Y
F031108Metagenome / Metatranscriptome183Y
F037419Metagenome / Metatranscriptome168Y
F040128Metagenome / Metatranscriptome162Y
F044539Metagenome / Metatranscriptome154N
F045792Metagenome / Metatranscriptome152Y
F049933Metagenome / Metatranscriptome146Y
F056633Metagenome / Metatranscriptome137Y
F058438Metagenome / Metatranscriptome135Y
F074016Metagenome / Metatranscriptome120Y
F075328Metagenome / Metatranscriptome119Y
F098038Metagenome / Metatranscriptome104Y
F105299Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186577_101843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1653Open in IMG/M
Ga0186577_102479All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Sapindaceae → Hippocastanoideae → Acereae → Acer → Acer yangbiense1478Open in IMG/M
Ga0186577_102535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1465Open in IMG/M
Ga0186577_103222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1320Open in IMG/M
Ga0186577_103393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia1286Open in IMG/M
Ga0186577_104109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1159Open in IMG/M
Ga0186577_104700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1060Open in IMG/M
Ga0186577_104922Not Available1029Open in IMG/M
Ga0186577_106065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea871Open in IMG/M
Ga0186577_106379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani839Open in IMG/M
Ga0186577_106422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea834Open in IMG/M
Ga0186577_106639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea811Open in IMG/M
Ga0186577_106841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea787Open in IMG/M
Ga0186577_106863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani784Open in IMG/M
Ga0186577_107596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
Ga0186577_107814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum691Open in IMG/M
Ga0186577_108287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea649Open in IMG/M
Ga0186577_108809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea605Open in IMG/M
Ga0186577_109031Not Available584Open in IMG/M
Ga0186577_109066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
Ga0186577_109280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186577_101843Ga0186577_1018433F044539MTPLPPTADPKKWRRNYDNLGDKDRQEMLVDEIFALYLYRMSNRVNQYYYKIVLAYVIFFRECLNEYGWGKKIESENINIDSNPELKQDIETKLFCLVNNAEHAPEICNEFVTVYMEYKKTIFDIPKHDQIDLTINLCHWLFECQFTCSKLTMIA
Ga0186577_102479Ga0186577_1024792F009426MSAKVNKDVKLSLYMVLGETSYSIIIFMTTSPCVISVGAAREALFEGKADYCMFVCE
Ga0186577_102535Ga0186577_1025351F074016MPAGIPQPPDSVLENLISECEDHTFWLNFRKAAPMLFCAAVEHNNDIKQVRDLSFMEELLKVKSMMNVMASKLGQSDAGIDIIEYSMATQMLENKLSVLKSLNTTVDGDNEEKLTFNVQGTNKAV
Ga0186577_103222Ga0186577_1032221F075328MKVLNKYWDSDLCLTKIKINEKMKTVGFDTKNNRLSIVTYDRTIYFVDIPKEQTRYIESTECRFY
Ga0186577_103393Ga0186577_1033932F058438MTEEDPEALANEPLSPSLDSQLEMMVPSGRRFTGRMFPTEREAGESRIN
Ga0186577_104109Ga0186577_1041092F049933LKPTQIPRGCYREIRKFNACTVEKSKEACVNEKISIMEVCPEHVLEGLREKRKWMLRAETIDNQTYKRAMTVSDFNKGRSVADLECKDWTYGHPSNLRGESTWQDDRYDPTKYSHPHRYDNVNFPEQEYKDVFGGTMGTAAAAEADKYKIGLLSGTSTAMMEHEANKRKESLKTAVPKKE
Ga0186577_104693Ga0186577_1046931F098038LKSREATVLKMTTQTFIKYDKEYLPGYTGHVPKKNEIFGCTAGDINKIITKKGQKPSEHDIDVAVIKP
Ga0186577_104700Ga0186577_1047001F000787MKFFAIAALFAAVEAKHHHHNTEFVDISGKPPAVGLGHAVIPATREEYDNAATLWKGDWAKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLASDC
Ga0186577_104922Ga0186577_1049221F056633MDKVREMAQKLGVPFTNDLMALGSNSAISDALIEKAVAAGKTEAQINAAMATL
Ga0186577_106065Ga0186577_1060651F012918KNMTSTHVKSLIPLKDSHLYASNGFASQDEQNAYDDRQRRMVNYQVTDYVENNDLVCFGLSSHDVEEWMPKYTKKAEHELNVLKSWIHGRDIEDLFVRPALKSDYNYNSYATRAQVRVALALAVIRELPVKNFYIRCWLVYGYYMFFVSNGLARGLKPARPLVIYQTQSERRTLLNYPDLFWWTQTRVLPRNPPMPSTDIEWRTRQTPVFHQYHKTTYRYRLRKPRFVPWDGSQNQPVMPFLHDSGTDVTNGTFRRNCNSTPALK
Ga0186577_106379Ga0186577_1063791F000935MKYTVAMCLLGAVASTQIDSTNQEKLFNLMQLQDGPCPEPLEITEDELHYQLGEFSRTFEMQYWDNAMKIKKELGEKGLNPRFAVTTKELYDKSFSFPKVRNYDYAVENMNELEHYEDNLNGNIGNNYHLQKFLEVAKKVRANLNDKYDIGFIDPGVEGDWQ
Ga0186577_106422Ga0186577_1064222F037419MWGLTVVSGIRFMIGFSKAPTTNGDEQEIYFRLNTIFQKNKFGYNTRFMSDFDLLLEGVLNERFIDESTLYYDNPVSTKEIEDVEQGLNGEVSEDDIKNMLKDKQVHGAHSKVTRYPGRMASNYTKSDDLSCYKVHPEGVKPKF
Ga0186577_106639Ga0186577_1066391F011523PWPRRKERKMTEYLYDRENPKSNFRQRLTGIEGFMYGNPNMNERADMIGRALAKETDGDFTKFVMKTAKPRDMAQKWRMFKNIARFVKNPFGYLFWKQMTITSQNRFRLTWFLLIWHLYQSFALYMLTKNKKEGMIHKWYWHIGMVNHYYGAPKSRYFFPADRKKNYVRYSNFHQMRQNKRTSMIHTNWWCRDQNFRKYFDMRKRNDIKPALSGFKDEPIYNEQMRQMQEWIDLRHSKQS
Ga0186577_106841Ga0186577_1068411F024569DYKNKMYYNYLNRDQLYLKSYRTHNLWFNQYHKKVRTPRVTAFHIGFLKRMGKSYSGTRVVAFMWGLTVVSGIRFMIGFSKAPTTNGDEQEIYFRLNTIFQKNKFGYNTRFMSDFDLLLEGVLNERFIDESTLYYDNPVSTKEIEDVEQGLNGEVSEDDIKNMLKDKQVHGAHSKVTRYPGRMASNYTKSDDLSCYKVHPEGVKPKF
Ga0186577_106863Ga0186577_1068632F011815MSFGVSFSQTKRNDHARELSTKVSTAIKEYSAKLLTKVESQAVETLTEQNAHNIAAVIFYDVQLQDAMKGLGMTEDADLVLAVNRLKSLQKLYLFEQRGGENYLG
Ga0186577_107020Ga0186577_1070201F000055YSSLFMIAAFLGASSVEQSQAVYLAKRKKKEDPLPTAADTPASGYYGADEDDVMNNIFNHYAVEVTNAAGQKTGQKVLYKDGAQKACAEVLLVTKQVSEAKMEQYMAEFFPRTWAKFDINNGGEIDITESHTFMRSLLGRLNQFVLAPGSLTDIKVE
Ga0186577_107530Ga0186577_1075301F031108VDGTTWKDMHISGFNGADEDEIMDNIFGRFSQEGRTPSGHKTGQKLLLKDDAKIAAGTILEAAHKLSPQDVPSYLDENFEKSWSHFDQNHEGWIRYEETHTFQRFLQGHLN
Ga0186577_107596Ga0186577_1075962F045792MDNAKIYAETVIRNKREALNVRRFGVKMTALSAKIESAARTQQMS
Ga0186577_107814Ga0186577_1078141F105299VQQQLAQRRAQEEKDLEQSTEDLNYELFTFSKTLKPSAMHKALAIKEKMESQGHPPAHFRVSLVNLWSKGFKHEAVANYKFVKDKLQELDIAEKNLNRNIDSKAQLDIFLGTATDVKKQFKQRYGEAEWEP
Ga0186577_108287Ga0186577_1082871F019022EEMVFHVTNYMRETNVWAIRKVRWITWSLGLSIPIYRNTYWDYLGRRVAWKDSLGYYGDEDYKKKNNEELKANWGYTPRYDPVYWFSMKKRKY
Ga0186577_108585Ga0186577_1085851F000075FFAVAALATVSANTYDFMGEDELLSQLSSTLASAQRSEARGDGDAAVAKTAAIKNIQKALTARILKRLDDGQPLVEVARKMKAIEGMQPQINDMERRLGIMQSVEPVLENAIKTLQKVVDVRGMGKK
Ga0186577_108809Ga0186577_1088091F018935MPKYSYYDYIYNYNSKFLNKYQSDTHWYSGRGSHFMELLRVKSVRLKSNRNWMWFDIRFGTKFLYMIYMPQLFFVTISYLLSPAWRRLDERYHLRFAEGETDDIDDVEPFVTHDQRKKPMTRRKYADVVKIVYGGVEEYDYVTDQPMRYR
Ga0186577_109031Ga0186577_1090311F001461KVYFRKMKFALATIALLATVEAKGEGFPEHLGEMFPNKESMYGSDWEKYKKTRQLMVDCDIYESENWLGTGKCKYSWECRGARMCEGQGWCYGDDSCEEVHE
Ga0186577_109066Ga0186577_1090661F015263MEKDKKQKHPIFNGEYEILSSLGEGNTSKVYLARSLEDPKKQVALKLLREEFLSRDEESIKSVEQEI
Ga0186577_109280Ga0186577_1092801F040128TMKFAQLALFFAGAAQALKLTSNSQQTALEQVADPCEEALEVSKEELEIQLDYFSRTFDRKFYDNAMKIHEELVKQGQNPKLSVHSWELYDQSFAFPRVRRYDLVQQQMDLLQHFEDNLNQNFTNLQHLANFIRVGKQAESTLNEKYHDGEFSDPAGFDPQDEHKTTWATVKL
Ga0186577_109887Ga0186577_1098871F000075MKFAAVAALATVSANKYDSMNEDELLVNLESTLSSALSSEARGDGDAAVAKTAAIKNIQKALTARILKRLDDGQPLVEVARKMKAIEGMQPQINDMERRLGIMQSVEPVLENAIKTLQKVVDVRGMGKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.