NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F013428

Metagenome / Metatranscriptome Family F013428

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F013428
Family Type Metagenome / Metatranscriptome
Number of Sequences 271
Average Sequence Length 42 residues
Representative Sequence MSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Number of Associated Samples 168
Number of Associated Scaffolds 271

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 60.52 %
% of genes near scaffold ends (potentially truncated) 15.87 %
% of genes from short scaffolds (< 2000 bps) 78.60 %
Associated GOLD sequencing projects 147
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.192 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(10.701 % of family members)
Environment Ontology (ENVO) Unclassified
(23.985 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(26.199 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 46.38%    β-sheet: 0.00%    Coil/Unstructured: 53.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 271 Family Scaffolds
PF00115COX1 36.53
PF04442CtaG_Cox11 33.95
PF00510COX3 9.96
PF02104SURF1 2.58
PF11137DUF2909 1.48
PF13500AAA_26 1.11
PF02790COX2_TM 1.11
PF03334PhaG_MnhG_YufB 0.74
PF01040UbiA 0.74
PF00116COX2 0.37
PF07715Plug 0.37
PF01979Amidohydro_1 0.37
PF11104PilM_2 0.37
PF02628COX15-CtaA 0.37
PF02386TrkH 0.37
PF06968BATS 0.37
PF10003DUF2244 0.37
PF00155Aminotran_1_2 0.37

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 271 Family Scaffolds
COG3175Cytochrome c oxidase assembly protein Cox11Posttranslational modification, protein turnover, chaperones [O] 33.95
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 9.96
COG3346Cytochrome oxidase assembly protein ShyY1Posttranslational modification, protein turnover, chaperones [O] 2.58
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 1.48
COG1320Multisubunit Na+/H+ antiporter, MnhG subunitInorganic ion transport and metabolism [P] 0.74
COG0168Trk-type K+ transport system, membrane componentInorganic ion transport and metabolism [P] 0.37
COG1612Heme A synthaseCoenzyme transport and metabolism [H] 0.37
COG4263Nitrous oxide reductaseInorganic ion transport and metabolism [P] 0.37


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.30 %
UnclassifiedrootN/A10.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000124|BS_KBA_SWE12_21mDRAFT_c10111802All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae665Open in IMG/M
3300000134|BS_KBA_SWE07_21mDRAFT_c1027979All Organisms → cellular organisms → Bacteria → Proteobacteria621Open in IMG/M
3300001213|JGIcombinedJ13530_104913655All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria544Open in IMG/M
3300002961|JGI11641J44799_10035823All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1453Open in IMG/M
3300003371|JGI26145J50221_1022593All Organisms → cellular organisms → Bacteria → Proteobacteria614Open in IMG/M
3300003432|JGI20214J51088_10271773All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1169Open in IMG/M
3300003858|Ga0031656_10012264All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3591Open in IMG/M
3300003858|Ga0031656_10044944All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1775Open in IMG/M
3300003858|Ga0031656_10093091All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1109Open in IMG/M
3300003859|Ga0031653_10036790All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1352Open in IMG/M
3300003861|Ga0031654_10009990All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2791Open in IMG/M
3300003991|Ga0055461_10132445All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria647Open in IMG/M
3300004048|Ga0055494_10079373All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria681Open in IMG/M
3300004050|Ga0055491_10107037All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria698Open in IMG/M
3300004151|Ga0066602_10415465All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria606Open in IMG/M
3300004154|Ga0066603_10491888All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria577Open in IMG/M
3300004155|Ga0066600_10278718All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria754Open in IMG/M
3300004155|Ga0066600_10679292Not Available521Open in IMG/M
3300004155|Ga0066600_10740511All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria502Open in IMG/M
3300004156|Ga0062589_100044654All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2420Open in IMG/M
3300004156|Ga0062589_100724234All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria887Open in IMG/M
3300004463|Ga0063356_105829883All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria528Open in IMG/M
3300004481|Ga0069718_10085624All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1217Open in IMG/M
3300004643|Ga0062591_102563126All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria537Open in IMG/M
3300004778|Ga0062383_10111371All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1184Open in IMG/M
3300004778|Ga0062383_10295106All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium776Open in IMG/M
3300004779|Ga0062380_10275635All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria704Open in IMG/M
3300004781|Ga0062379_10032897All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria970Open in IMG/M
3300004808|Ga0062381_10124331All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria833Open in IMG/M
3300005328|Ga0070676_10087857All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1898Open in IMG/M
3300005331|Ga0070670_102073828All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria524Open in IMG/M
3300005354|Ga0070675_100773321All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria877Open in IMG/M
3300005655|Ga0073905_10425820All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria559Open in IMG/M
3300005827|Ga0074478_1329118All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1945Open in IMG/M
3300005829|Ga0074479_10189993All Organisms → cellular organisms → Bacteria → Proteobacteria1587Open in IMG/M
3300005833|Ga0074472_10078306All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria883Open in IMG/M
3300005833|Ga0074472_10892568All Organisms → cellular organisms → Bacteria → Proteobacteria888Open in IMG/M
3300005836|Ga0074470_10665608All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium672Open in IMG/M
3300005940|Ga0073913_10059132All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria620Open in IMG/M
3300006040|Ga0073914_10033537All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria917Open in IMG/M
3300006092|Ga0082021_1004426All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5826Open in IMG/M
3300006092|Ga0082021_1114038All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria30466Open in IMG/M
3300006092|Ga0082021_1172796All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria88926Open in IMG/M
3300006224|Ga0079037_100040736All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3541Open in IMG/M
3300006224|Ga0079037_100042017All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3498Open in IMG/M
3300006224|Ga0079037_100198666All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1798Open in IMG/M
3300006224|Ga0079037_100392177All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales1312Open in IMG/M
3300006224|Ga0079037_100437291All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1245Open in IMG/M
3300006224|Ga0079037_100744503All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria959Open in IMG/M
3300006224|Ga0079037_101166305All Organisms → cellular organisms → Bacteria → Proteobacteria765Open in IMG/M
3300006224|Ga0079037_101254469All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria737Open in IMG/M
3300006224|Ga0079037_101257766All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria736Open in IMG/M
3300006224|Ga0079037_101319998All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria718Open in IMG/M
3300006224|Ga0079037_101848719All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria603Open in IMG/M
3300006606|Ga0074062_11581630All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300006844|Ga0075428_100062316All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4083Open in IMG/M
3300006844|Ga0075428_100447336All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1384Open in IMG/M
3300006845|Ga0075421_100393697All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales1665Open in IMG/M
3300006930|Ga0079303_10027349All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1890Open in IMG/M
3300006930|Ga0079303_10488034All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300009009|Ga0105105_10256248All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria929Open in IMG/M
3300009009|Ga0105105_10472723Not Available712Open in IMG/M
3300009009|Ga0105105_10532759All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium676Open in IMG/M
3300009068|Ga0114973_10000019All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria98836Open in IMG/M
3300009075|Ga0105090_10000525All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria18982Open in IMG/M
3300009075|Ga0105090_10022280All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae3903Open in IMG/M
3300009075|Ga0105090_10096472Not Available1851Open in IMG/M
3300009078|Ga0105106_10666458All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium744Open in IMG/M
3300009091|Ga0102851_11067754All Organisms → cellular organisms → Bacteria → Proteobacteria882Open in IMG/M
3300009091|Ga0102851_12991098Not Available543Open in IMG/M
3300009091|Ga0102851_13411396Not Available510Open in IMG/M
3300009111|Ga0115026_11405490All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria577Open in IMG/M
3300009120|Ga0117941_1081970All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1408Open in IMG/M
3300009131|Ga0115027_11060021Not Available639Open in IMG/M
3300009147|Ga0114129_13047080All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium549Open in IMG/M
3300009156|Ga0111538_10416659All Organisms → cellular organisms → Bacteria1701Open in IMG/M
3300009156|Ga0111538_13261806All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium565Open in IMG/M
3300009165|Ga0105102_10143455All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1158Open in IMG/M
3300009167|Ga0113563_10041615All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3789Open in IMG/M
3300009167|Ga0113563_10090101All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2772Open in IMG/M
3300009167|Ga0113563_11023990All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria952Open in IMG/M
3300009167|Ga0113563_13196780All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria555Open in IMG/M
3300009169|Ga0105097_10248610All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium980Open in IMG/M
3300009455|Ga0114939_10000426All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria35429Open in IMG/M
3300009455|Ga0114939_10007899All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales6034Open in IMG/M
3300009455|Ga0114939_10040485All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2046Open in IMG/M
3300009506|Ga0118657_10004961All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria21765Open in IMG/M
3300009506|Ga0118657_10064030All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5557Open in IMG/M
3300009506|Ga0118657_11366540All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria843Open in IMG/M
3300009509|Ga0123573_10177595All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2114Open in IMG/M
3300009509|Ga0123573_10339258All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae1449Open in IMG/M
3300009527|Ga0114942_1160911All Organisms → cellular organisms → Bacteria → Proteobacteria789Open in IMG/M
3300009540|Ga0073899_11127926All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium548Open in IMG/M
3300009609|Ga0105347_1263456Not Available712Open in IMG/M
3300009610|Ga0105340_1213391All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria816Open in IMG/M
3300009693|Ga0116141_10452688All Organisms → cellular organisms → Bacteria → Proteobacteria652Open in IMG/M
3300009868|Ga0130016_10219000All Organisms → cellular organisms → Bacteria → Proteobacteria1417Open in IMG/M
3300009868|Ga0130016_10566050All Organisms → cellular organisms → Bacteria → Proteobacteria714Open in IMG/M
3300009870|Ga0131092_10101096All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3400Open in IMG/M
3300009870|Ga0131092_10713261All Organisms → cellular organisms → Bacteria → Proteobacteria853Open in IMG/M
3300009870|Ga0131092_10898432Not Available728Open in IMG/M
3300010400|Ga0134122_10274599All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1435Open in IMG/M
3300010412|Ga0136852_10006154All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria13335Open in IMG/M
3300010997|Ga0139324_1004183All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium2180Open in IMG/M
3300012990|Ga0159060_1143096All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri669Open in IMG/M
3300013769|Ga0119887_1001660All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria8764Open in IMG/M
3300013769|Ga0119887_1002210All Organisms → cellular organisms → Bacteria → Proteobacteria7296Open in IMG/M
3300014260|Ga0075307_1002327All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2894Open in IMG/M
3300014295|Ga0075305_1141452All Organisms → cellular organisms → Bacteria → Proteobacteria513Open in IMG/M
3300014298|Ga0075341_1009177All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1198Open in IMG/M
3300014315|Ga0075350_1061623All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria826Open in IMG/M
3300014316|Ga0075339_1008081All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2314Open in IMG/M
3300014319|Ga0075348_1220720Not Available532Open in IMG/M
3300014322|Ga0075355_1172709All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria587Open in IMG/M
3300014864|Ga0180068_1052743All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria670Open in IMG/M
3300014885|Ga0180063_1025943All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1619Open in IMG/M
3300017792|Ga0163161_12102681All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria502Open in IMG/M
3300017965|Ga0190266_10117773All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1129Open in IMG/M
3300018029|Ga0187787_10345208All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium572Open in IMG/M
3300018083|Ga0184628_10320956All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium813Open in IMG/M
3300018083|Ga0184628_10656268All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium526Open in IMG/M
3300018422|Ga0190265_10923513All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium995Open in IMG/M
3300018429|Ga0190272_10222892All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1387Open in IMG/M
3300018469|Ga0190270_11356508All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria756Open in IMG/M
3300018476|Ga0190274_10333849All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1432Open in IMG/M
3300018481|Ga0190271_11338742All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria836Open in IMG/M
3300021859|Ga0210334_10252426All Organisms → cellular organisms → Bacteria → Proteobacteria809Open in IMG/M
3300022204|Ga0224496_10080311All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1440Open in IMG/M
3300022213|Ga0224500_10000916All Organisms → cellular organisms → Bacteria → Proteobacteria18459Open in IMG/M
3300022213|Ga0224500_10097337All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1124Open in IMG/M
3300022213|Ga0224500_10103957Not Available1082Open in IMG/M
3300022214|Ga0224505_10000304All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria34253Open in IMG/M
3300022214|Ga0224505_10028178All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2454Open in IMG/M
3300022221|Ga0224506_10218477All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria875Open in IMG/M
3300022549|Ga0212091_10167359All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium876Open in IMG/M
3300023073|Ga0247744_1012813All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1134Open in IMG/M
3300024056|Ga0124853_1010951Not Available1922Open in IMG/M
3300024056|Ga0124853_1439750All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2523Open in IMG/M
3300024056|Ga0124853_1455644Not Available1908Open in IMG/M
3300025106|Ga0209398_1002812All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans7639Open in IMG/M
3300025130|Ga0209594_1001371All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans12232Open in IMG/M
3300025130|Ga0209594_1004385All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans6345Open in IMG/M
3300025550|Ga0210098_1041525All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria734Open in IMG/M
3300025555|Ga0210121_1003296All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3173Open in IMG/M
3300025908|Ga0207643_10479498All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria794Open in IMG/M
3300025925|Ga0207650_11337315All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria610Open in IMG/M
3300025948|Ga0210088_1019652Not Available1017Open in IMG/M
3300025968|Ga0210103_1009532All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1732Open in IMG/M
3300025975|Ga0210091_1013574Not Available782Open in IMG/M
3300025980|Ga0210137_1045916Not Available637Open in IMG/M
3300026485|Ga0256805_1015523All Organisms → cellular organisms → Bacteria → Proteobacteria839Open in IMG/M
3300027683|Ga0209392_1004781All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans3899Open in IMG/M
3300027683|Ga0209392_1065740All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1172Open in IMG/M
3300027683|Ga0209392_1088244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria992Open in IMG/M
3300027693|Ga0209704_1117533All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria762Open in IMG/M
3300027715|Ga0208665_10006992All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2632Open in IMG/M
3300027716|Ga0209682_10006301All Organisms → cellular organisms → Bacteria3116Open in IMG/M
3300027721|Ga0209492_1308282All Organisms → cellular organisms → Bacteria → Proteobacteria526Open in IMG/M
3300027778|Ga0209464_10083662All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1080Open in IMG/M
3300027778|Ga0209464_10253562All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria635Open in IMG/M
3300027778|Ga0209464_10380658All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium519Open in IMG/M
3300027796|Ga0209373_10314468All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria635Open in IMG/M
3300027802|Ga0209476_10331047Not Available656Open in IMG/M
3300027831|Ga0209797_10037445All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2188Open in IMG/M
3300027841|Ga0209262_10021488All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans2743Open in IMG/M
3300027841|Ga0209262_10110106All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1300Open in IMG/M
3300027841|Ga0209262_10179217All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1021Open in IMG/M
3300027841|Ga0209262_10208664All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria946Open in IMG/M
3300027841|Ga0209262_10458604All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium621Open in IMG/M
3300027871|Ga0209397_10637386All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium534Open in IMG/M
3300027877|Ga0209293_10364897All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria743Open in IMG/M
3300027885|Ga0209450_10020031All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans3772Open in IMG/M
3300027885|Ga0209450_10040717All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2808Open in IMG/M
3300027885|Ga0209450_10113971All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1816Open in IMG/M
3300027885|Ga0209450_10285712All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1189Open in IMG/M
3300027885|Ga0209450_10471316All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans919Open in IMG/M
3300027887|Ga0208980_10005595All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans7533Open in IMG/M
3300027890|Ga0209496_10144969All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1078Open in IMG/M
3300027890|Ga0209496_10333398All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans770Open in IMG/M
3300027897|Ga0209254_10230631All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1459Open in IMG/M
3300027899|Ga0209668_10087757All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1780Open in IMG/M
3300027899|Ga0209668_10131951All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1494Open in IMG/M
3300027899|Ga0209668_10134174All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1483Open in IMG/M
3300027899|Ga0209668_10159549All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1375Open in IMG/M
3300027899|Ga0209668_10219730All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1191Open in IMG/M
3300027899|Ga0209668_10222623All Organisms → cellular organisms → Bacteria → Proteobacteria1184Open in IMG/M
3300027899|Ga0209668_10353646All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria954Open in IMG/M
3300027899|Ga0209668_10419523All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria878Open in IMG/M
3300027900|Ga0209253_10007747All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria9257Open in IMG/M
3300027900|Ga0209253_10376319All Organisms → cellular organisms → Bacteria → Proteobacteria1084Open in IMG/M
3300027900|Ga0209253_10623241All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria788Open in IMG/M
3300027900|Ga0209253_10876554All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium631Open in IMG/M
3300027902|Ga0209048_10010036All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans8531Open in IMG/M
3300027902|Ga0209048_10073057All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae2712Open in IMG/M
3300027909|Ga0209382_10092127All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans3560Open in IMG/M
3300027917|Ga0209536_101017576All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae1021Open in IMG/M
3300027972|Ga0209079_10005856All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans4232Open in IMG/M
3300027972|Ga0209079_10194738All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium693Open in IMG/M
3300028647|Ga0272412_1082457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium1370Open in IMG/M
3300030606|Ga0299906_10033976All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans4075Open in IMG/M
3300030619|Ga0268386_10000026All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria70554Open in IMG/M
3300031665|Ga0316575_10053915All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1601Open in IMG/M
3300031772|Ga0315288_10348876All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales1523Open in IMG/M
3300031834|Ga0315290_10099383All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans2450Open in IMG/M
3300031834|Ga0315290_10223242All Organisms → cellular organisms → Bacteria → Proteobacteria1641Open in IMG/M
3300031834|Ga0315290_10245891All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1561Open in IMG/M
3300031834|Ga0315290_10341313All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1312Open in IMG/M
3300031834|Ga0315290_10341887All Organisms → cellular organisms → Eukaryota1311Open in IMG/M
3300031857|Ga0315909_10942372All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria528Open in IMG/M
3300031873|Ga0315297_10008687All Organisms → cellular organisms → Bacteria → Proteobacteria6851Open in IMG/M
3300031873|Ga0315297_10433045Not Available1104Open in IMG/M
3300031873|Ga0315297_10613431Not Available913Open in IMG/M
3300031940|Ga0310901_10001979All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4583Open in IMG/M
3300031997|Ga0315278_10614324All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1112Open in IMG/M
3300032092|Ga0315905_11178898All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria627Open in IMG/M
3300032143|Ga0315292_10763087All Organisms → cellular organisms → Bacteria → Proteobacteria811Open in IMG/M
3300032156|Ga0315295_11615075Not Available621Open in IMG/M
3300032164|Ga0315283_11878692All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria600Open in IMG/M
3300032177|Ga0315276_11120846All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium832Open in IMG/M
3300032180|Ga0307471_103876779All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria529Open in IMG/M
3300032256|Ga0315271_10647728Not Available905Open in IMG/M
3300032256|Ga0315271_10901072Not Available763Open in IMG/M
3300032256|Ga0315271_11526202All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium575Open in IMG/M
3300032342|Ga0315286_11720265All Organisms → cellular organisms → Bacteria → Proteobacteria593Open in IMG/M
3300032397|Ga0315287_10003671All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans14828Open in IMG/M
3300032397|Ga0315287_10501179All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1441Open in IMG/M
3300032397|Ga0315287_11079968All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans930Open in IMG/M
3300032397|Ga0315287_11087866All Organisms → cellular organisms → Bacteria → Proteobacteria926Open in IMG/M
3300032397|Ga0315287_12463147All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria560Open in IMG/M
3300033004|Ga0335084_11517655All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium662Open in IMG/M
3300033406|Ga0316604_10512713All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria659Open in IMG/M
3300033406|Ga0316604_10798913Not Available518Open in IMG/M
3300033406|Ga0316604_10837385All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium505Open in IMG/M
3300033408|Ga0316605_10666920All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria978Open in IMG/M
3300033408|Ga0316605_11426013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288671Open in IMG/M
3300033408|Ga0316605_11434669All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium669Open in IMG/M
3300033408|Ga0316605_11496931All Organisms → cellular organisms → Bacteria → Proteobacteria655Open in IMG/M
3300033408|Ga0316605_12151818Not Available543Open in IMG/M
3300033408|Ga0316605_12349165Not Available518Open in IMG/M
3300033408|Ga0316605_12433785All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria509Open in IMG/M
3300033413|Ga0316603_10421679All Organisms → cellular organisms → Bacteria → Proteobacteria1210Open in IMG/M
3300033413|Ga0316603_10582956All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1036Open in IMG/M
3300033413|Ga0316603_10718849All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria934Open in IMG/M
3300033413|Ga0316603_12255987All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium513Open in IMG/M
3300033414|Ga0316619_10584764All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans925Open in IMG/M
3300033414|Ga0316619_10612182All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans907Open in IMG/M
3300033418|Ga0316625_100396461All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1039Open in IMG/M
3300033418|Ga0316625_101426421All Organisms → cellular organisms → Bacteria → Proteobacteria650Open in IMG/M
3300033418|Ga0316625_102436520Not Available527Open in IMG/M
3300033419|Ga0316601_100599574All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1070Open in IMG/M
3300033419|Ga0316601_101156488All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans775Open in IMG/M
3300033434|Ga0316613_10108975All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1700Open in IMG/M
3300033482|Ga0316627_100127642All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1817Open in IMG/M
3300033482|Ga0316627_100528569All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1055Open in IMG/M
3300033483|Ga0316629_11316373All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium582Open in IMG/M
3300033485|Ga0316626_10232673All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1467Open in IMG/M
3300033485|Ga0316626_10370363All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1188Open in IMG/M
3300033487|Ga0316630_10021277All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans3536Open in IMG/M
3300034052|Ga0373889_010515All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1259Open in IMG/M
3300034052|Ga0373889_021643Not Available929Open in IMG/M
3300034054|Ga0373891_033730All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri785Open in IMG/M
3300034128|Ga0370490_0022335All Organisms → cellular organisms → Bacteria2117Open in IMG/M
3300034148|Ga0364927_0116407All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium752Open in IMG/M
3300034149|Ga0364929_0261250All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium584Open in IMG/M
3300034149|Ga0364929_0267749Not Available578Open in IMG/M
3300034150|Ga0364933_168268Not Available570Open in IMG/M
3300034151|Ga0364935_0017066All Organisms → cellular organisms → Bacteria1922Open in IMG/M
3300034169|Ga0370480_0004625All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans5057Open in IMG/M
3300034176|Ga0364931_0014685All Organisms → cellular organisms → Bacteria2130Open in IMG/M
3300034194|Ga0370499_0203000Not Available533Open in IMG/M
3300034196|Ga0370503_0229346All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium666Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil10.70%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment9.23%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment8.49%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands7.75%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment5.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater4.06%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.32%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment3.69%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater2.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.95%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment2.58%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.58%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.58%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland2.21%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.21%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.85%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland1.48%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.48%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.48%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge1.48%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment1.11%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment1.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.11%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.11%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge1.11%
Wastewater Treatment PlantEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant1.11%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry1.11%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.74%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.74%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.74%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.74%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.74%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.74%
Sewage Treatment PlantEngineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant0.74%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.37%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.37%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.37%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.37%
Lake SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment0.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.37%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.37%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.37%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.37%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.37%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.37%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments0.37%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300000134Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 07_21mEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300002961Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300003371Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PMHost-AssociatedOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003858Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DIEnvironmentalOpen in IMG/M
3300003859Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BREnvironmentalOpen in IMG/M
3300003861Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CREnvironmentalOpen in IMG/M
3300003991Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004048Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2EnvironmentalOpen in IMG/M
3300004050Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2EnvironmentalOpen in IMG/M
3300004151Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5EnvironmentalOpen in IMG/M
3300004154Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8EnvironmentalOpen in IMG/M
3300004155Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300004781Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2FreshEnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005655Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_supernatantEngineeredOpen in IMG/M
3300005827Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBAEnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005940Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14EnvironmentalOpen in IMG/M
3300006040Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_30-Apr-14EnvironmentalOpen in IMG/M
3300006092Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, SingaporeEngineeredOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009120Lake sediment microbial communities from Tanners Lake, St. Paul, MNEnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009455Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal SpringEnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009509Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11EnvironmentalOpen in IMG/M
3300009527Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold CreekEnvironmentalOpen in IMG/M
3300009540Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-PhEngineeredOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009693Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaGEngineeredOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010412Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10EnvironmentalOpen in IMG/M
3300010997ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)EnvironmentalOpen in IMG/M
3300012990Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015EngineeredOpen in IMG/M
3300013769Sewage treatment plant microbial communities from Vermont, USA - Sand_BEngineeredOpen in IMG/M
3300014260Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014295Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1EnvironmentalOpen in IMG/M
3300014298Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300014315Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1EnvironmentalOpen in IMG/M
3300014316Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1EnvironmentalOpen in IMG/M
3300014319Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1EnvironmentalOpen in IMG/M
3300014322Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1EnvironmentalOpen in IMG/M
3300014864Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10DEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300021859Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022204Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022221Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300022549Cold Creek_combined assemblyEnvironmentalOpen in IMG/M
3300023073Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5EnvironmentalOpen in IMG/M
3300024056Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300025106Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes)EnvironmentalOpen in IMG/M
3300025130Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes)EnvironmentalOpen in IMG/M
3300025550Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025555Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025948Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025968Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025975Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025980Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026485Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 F6EnvironmentalOpen in IMG/M
3300027683Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027715Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)EnvironmentalOpen in IMG/M
3300027716Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027796Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 (SPAdes)EnvironmentalOpen in IMG/M
3300027802Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate (SPAdes)EngineeredOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027841Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027871Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028647Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031665Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3Host-AssociatedOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033406Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CTEnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300034052Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.2EngineeredOpen in IMG/M
3300034054Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.1EngineeredOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M
3300034169Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M
3300034194Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17EnvironmentalOpen in IMG/M
3300034196Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BS_KBA_SWE12_21mDRAFT_1011180223300000124MarineVSGKQVNDGPTDEQRRGIRRTTILLALVALAIYVAFIASGVIKSQH*
BS_KBA_SWE07_21mDRAFT_102797923300000134MarineVSGNDVANGPTDQQRRGIRRTTILLVLVALAIYVAFIASGVMKAQH*
JGIcombinedJ13530_10491365523300001213WetlandVTGTRMSQFTTEQRRRIRWTTILLAATAIGIYVAFIASSVMKAPH*
JGI11641J44799_1003582313300002961WetlandDVNDGPTDEQRRGIRRTAILLALVALAIYVAFIASGVMKAQH*
JGI26145J50221_102259323300003371Arabidopsis Thaliana RhizosphereVTGDPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP*
JGI20214J51088_1027177323300003432WetlandMSDKDVAGGPTDEQRRSIRRTTILLSLVALAIYVAFIASGVIKAQH*
Ga0031656_1001226423300003858Freshwater Lake SedimentVTAAPMNSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP*
Ga0031656_1004494423300003858Freshwater Lake SedimentMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0031656_1009309133300003858Freshwater Lake SedimentKGMALQEMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0031653_1003679023300003859Freshwater Lake SedimentMAERDPTXEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0031654_1000999033300003861Freshwater Lake SedimentMATRMSHGPTEEQRRRIRWTTLVLALTALGIYFAFIASAMMKAPHP*
Ga0055461_1013244523300003991Natural And Restored WetlandsVSDKQPKDGPTEEQRRGIRRTTILLVLVALAIYVAFIASGVMKAQH*
Ga0055494_1007937313300004048Natural And Restored WetlandsVSDKQPKDGPTEEQRRGIRRTTILLVLVALAIYVAFIASGVMKAQH
Ga0055491_1010703723300004050Natural And Restored WetlandsVSDKQPKDGPTEEQRRGIRRTTILLVLVALAIYAAFIASGVMKAQH*
Ga0066602_1041546523300004151FreshwaterMALQEMAEREPTAEQRRRIRRSAIVLALIAIAVYVAFIASGVMKAQP*
Ga0066603_1049188823300004154FreshwaterMTERNPTVTAEQRRRVRRTAIVLAVVAIAIYVAFIASGVMSARG*
Ga0066600_1027871823300004155FreshwaterMNSQQTDEQRRRIRRTTIVLALVALAIYVAFIASGVMKAQH*
Ga0066600_1067929213300004155FreshwaterMNAGPTDEQRRRIRRTTVLLALVALGIYVAFIASSMMKAQP*
Ga0066600_1074051113300004155FreshwaterSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP*
Ga0062589_10004465423300004156SoilVTGELPDDGRRRRIRRNTVVLALIAIAIYVAFIASGVIKSQP*
Ga0062589_10072423413300004156SoilGDRTDEQRRRIRRNTLLLTLVALAIYVAFIASSVLHAQA*
Ga0063356_10582988323300004463Arabidopsis Thaliana RhizosphereMTQGNQADEQRRRVRRNAILLGLVALGIYVAFIASSVLSAAP*
Ga0069718_1008562423300004481SedimentMALQDMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0062591_10256312623300004643SoilMTERGPTEEQRRRIRRTAIVLAVVAIGIYVIFIASGVMKAQP*
Ga0062383_1011137123300004778Wetland SedimentMTELDPDAEQRRRIRRTAIVLAAVAIAIYVAFIASGVMKAQP*
Ga0062383_1029510613300004778Wetland SedimentMSNGPTEEQRRRIRWTTILLALTAIGIYVAFIASAMTKAQH*
Ga0062380_1027563523300004779Wetland SedimentMTELDPAAEQRRRIRRTAIVLAAVAIAIYVAFIASGVMKAQP*
Ga0062379_1003289723300004781Wetland SedimentMNSQQTDEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP*
Ga0062381_1012433123300004808Wetland SedimentVSDKNVTGGPTDEQRRSIRRTTILLSLVALAIYVAFIASGVMKAQH*
Ga0070676_1008785743300005328Miscanthus RhizosphereVTGAPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP*
Ga0070670_10207382823300005331Switchgrass RhizosphereVTGELPDDGRRRRIRRNTVVLALIALAIYVAFIASGVIKSQP*
Ga0070675_10077332113300005354Miscanthus RhizosphereMAERDPTEEQRRRIRRTAIVLAVVAIGIYVIFIASGVMKAQP*
Ga0073905_1042582023300005655Activated SludgeMAERDPTAEQRRRIRRSAIVLALVAIAVYVAFIASGLMKAQP*
Ga0074478_132911833300005827Sediment (Intertidal)MAQHEPSAEQRRRVRRSAIVLAVVAIAIYVAFIASGVLGARG*
Ga0074479_1018999333300005829Sediment (Intertidal)VSSSEVTSNGPTEEQRRAIRRSTIVLVLVALAIYVAFIASGVIKAQP*
Ga0074472_1007830613300005833Sediment (Intertidal)VSGHDVKDGPTEEQRRGIRRTTILLALVAIAIYVAFIASGVIKAQH*
Ga0074472_1089256823300005833Sediment (Intertidal)VTNGPTDEQKRGIRRTAVLLALVALAIYVAFIASGVMKAQH*
Ga0074470_1066560813300005836Sediment (Intertidal)PHLRRSTRRQVSGIKVSDGPTEEQRRGIRRTTIVLALVALAIYVAFIASSVIRAQH*
Ga0073913_1005913223300005940SandMNSQQTDAQRRRIRRTAIVLALVALGIYVTFIATGVMKAQP*
Ga0073914_1003353733300006040SandMNGQQTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP*
Ga0082021_100442623300006092Wastewater Treatment PlantMTQDTRDEERRRRDIRRTTVLLVLVALGIYVAFIASGVMQARP*
Ga0082021_111403823300006092Wastewater Treatment PlantMTNGPTDEQRRRIRWTTFVLALTALGIYVAFIASSVLKAQH*
Ga0082021_1172796783300006092Wastewater Treatment PlantVNDRPANTGPSEQQRRRIRRTTVLLVLVAVGIYVAFIASGIMKAQP*
Ga0079037_10004073623300006224Freshwater WetlandsVTNGPTDEQKRGIRRTAILLALVALAIYVAFIASGVMKAQH*
Ga0079037_10004201723300006224Freshwater WetlandsMNSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP*
Ga0079037_10019866633300006224Freshwater WetlandsMAERDPTAEQRRRIRRSAIVLAVVALAIYVAFIASGVMKAQP*
Ga0079037_10039217723300006224Freshwater WetlandsMQNGISEEQRRRIRRTTVVLALVALAIYVAFIASGVMKAQP*
Ga0079037_10043729123300006224Freshwater WetlandsMAERDPTEEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0079037_10074450323300006224Freshwater WetlandsMDSQQTEQQRRRIRRTTIVLALVALGIYVAFIASGMMKAMP*
Ga0079037_10116630523300006224Freshwater WetlandsMAERDPTAAQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0079037_10125446913300006224Freshwater WetlandsMNAGPTDEQRRRIRRTTILLALVALGIYVAFIASGVMKAQP*
Ga0079037_10125776623300006224Freshwater WetlandsMSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP*
Ga0079037_10131999823300006224Freshwater WetlandsMNAGQTDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP*
Ga0079037_10184871923300006224Freshwater WetlandsMNAGRSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP*
Ga0074062_1158163023300006606SoilMSNGPTEEQRRRIRWTTLLLALTALGIYVAFIASAMLKAQH*
Ga0075428_10006231623300006844Populus RhizosphereVTGEPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP*
Ga0075428_10044733623300006844Populus RhizosphereVTGDLSEEERRRRIRRSSVILALVALAIYVAFIASGVLKS*
Ga0075421_10039369733300006845Populus RhizosphereVTGEPDDDRRRRIRRNSVVLALTALAIYVAFIASGVIKSQP*
Ga0079303_1002734923300006930Deep SubsurfaceMSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQH*
Ga0079303_1048803423300006930Deep SubsurfaceGPTDEQRRRIRRTALVLALVALGIYATFIASGVMRAQG*
Ga0105105_1025624823300009009Freshwater SedimentMNQDTQADAQRRRIRRTAVVLALVALAIYVAFIASGVMKAQA*
Ga0105105_1047272313300009009Freshwater SedimentMTERNPTVTAEQRRRVRRTAIVLAVVAIAIYVAFIASGVMSARA*
Ga0105105_1053275923300009009Freshwater SedimentMAERDPIAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0114973_10000019593300009068Freshwater LakeVSDEPTPEQRRRIRRTTFLLVLTALGIYVAFIASGVMKANGHG*
Ga0105090_10000525163300009075Freshwater SedimentMTAGGPSDEQRRRIRRTTIVLVIVALGIYVAFIASGVMKAQP*
Ga0105090_1002228023300009075Freshwater SedimentMAERDPTNEQRRRIRRTAIVLAVVAIGIYVAFIASGVMKAQP*
Ga0105090_1009647223300009075Freshwater SedimentMTEQDPSLAQRRRIRRTALLLAAVALAIYVAFIASGVMKAQG*
Ga0105106_1066645813300009078Freshwater SedimentAEREPTAEQRRRIRRSAIVLALVAIAVYVAFIASGVMKAQP*
Ga0102851_1106775423300009091Freshwater WetlandsMALQDMAERDPTAEQRRRIRRSAIVLAVVALAIYVAFIASGVMKAQP*
Ga0102851_1299109813300009091Freshwater WetlandsMNAGRSDEQRRRIRRTTILLVLVALGIYVAFIASGIL
Ga0102851_1341139623300009091Freshwater WetlandsVSTGPTDEQRRRIRRTTFVLALVALGIYVAFIASGVMQARG*
Ga0115026_1140549023300009111WetlandMNAGQTDEQRRRIRRTTILLALVALGIYVAFIASGVMKAQP*
Ga0117941_108197033300009120Lake SedimentMAQDSQTAEQRRRIRRTAILLGVVALAIYVAFIASGVMKAQP*
Ga0115027_1106002123300009131WetlandMALQEMAEREPTAEQRRRIRRSAIVLALVAIAVYVAFIASGVMKAQS*
Ga0114129_1304708023300009147Populus RhizosphereVTGTPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP*
Ga0111538_1041665923300009156Populus RhizosphereVTGAPDDERRRRIRRNSVVLALTALAIYVAFIASGV
Ga0111538_1326180623300009156Populus RhizosphereTGAPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP*
Ga0105102_1014345533300009165Freshwater SedimentMTEHDPTDAQRRRIRRTALLLAAVALAIYVAFIASGVMKAQG*
Ga0113563_1004161523300009167Freshwater WetlandsMNAGPSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP*
Ga0113563_1009010143300009167Freshwater WetlandsVTAAPMNSQQTDAQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP*
Ga0113563_1102399023300009167Freshwater WetlandsMDSQQTEQQRRRIRRTTIVLALVALGIYVAFIASGMMKATP*
Ga0113563_1319678023300009167Freshwater WetlandsMNAGPTDEQRRRIRRTTILLALVAIGIYVAFIASGVMKAQP*
Ga0105097_1024861023300009169Freshwater SedimentMAERDPTAAQCGRIRRSAIVLAVVAIAIYAAFIASGVMKAQP*
Ga0114939_10000426323300009455GroundwaterMTEPTAEQRRRVRRSAIMLAVVAIAIYVAFIASGVFGARG*
Ga0114939_1000789983300009455GroundwaterMQNGTSEEQRRRIRRTTVVLALVAVAIYVAFIASGVMKAQP*
Ga0114939_1004048533300009455GroundwaterVSEGRASTGTTAEQRRRIRRTTILLVLIALGIYVAFIASGVMKAQP*
Ga0118657_1000496153300009506Mangrove SedimentVSNVDSRPGDEQQRRRIRRTAILLALTALGIYVAFIASGIMKATP*
Ga0118657_1006403073300009506Mangrove SedimentVSDRPLNAGPSEEQRRRIRRMTIVLVLVALAIYVAFIASGVMQARS*
Ga0118657_1136654023300009506Mangrove SedimentLNAGPTGEQRRRIRRTTIVLALVAIAIYVTFIASGVLGRYG*
Ga0123573_1017759523300009509Mangrove SedimentMRTGPDEQQRRRIRRSTIVLALVALGIYVAFIASGVMQARG*
Ga0123573_1033925823300009509Mangrove SedimentVSGVDSRPGDEQQRRRIRRTAILLALTALGIYVAFIASGIMKATP*
Ga0114942_116091123300009527GroundwaterVPALNDMAEHDPTNEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP*
Ga0073899_1112792623300009540Activated SludgeAEQRRRIRRSAIVLAVVAIAIYAAFIASGVMKAQP*
Ga0105347_126345623300009609SoilVTGELPDDERRRRIRRNTVVLALIALAIYVAFIASGVIKSQP*
Ga0105340_121339123300009610SoilVTGERPTEQRRRIRRNTLLLALTAVAIYVAFIVSGVIKAQP*
Ga0116141_1045268823300009693Anaerobic Digestor SludgeMTNGPTEEQRRRIRWTTFVLALTALGIYVAFIASSVLKAQP*
Ga0130016_1021900023300009868WastewaterMNAGPTDEQRRRIRRTTIVLVLVALGIYVAFIASGMMGARS*
Ga0130016_1056605023300009868WastewaterMNAGPTDEQRRRIRRTTIVLVLVALGIYVAFIASSIMGARS*
Ga0131092_1010109623300009870Activated SludgeVDNGPNEQQRRGIRRTTILLALVALAIYVAFIASGVIKSQH*
Ga0131092_1071326123300009870Activated SludgeMSNGPTDQQRRRIRWTTILLVATALGIYVAFIASSVMKAQH*
Ga0131092_1089843213300009870Activated SludgeMDTRMSNGPTDEQRRRIRWTTFLLVVTALGIYVAFIVSSVM
Ga0134122_1027459923300010400Terrestrial SoilVTGELPDDGRRRRIRRSSVVLALIALAIYVAFIASGVIKSQT*
Ga0136852_1000615423300010412Mangrove SedimentMDRGPSDDERRRIRRMAILLALTALGIYVAFIASGIMKAQP*
Ga0139324_100418323300010997SedimentMDRGPGDDERRRIRRTAILLALTALGIYVAFIASGIMKAQP*
Ga0159060_114309623300012990Hydrocarbon Resource EnvironmentsMAQDKDEQRRRIRRTAILLVVVALGIYVAFIASSVMSVQP*
Ga0119887_100166073300013769Sewage Treatment PlantVSGIKVSDGPTEEQRRGIRRTTIVLALVALAIYVAFIASSVIKAQH*
Ga0119887_1002210103300013769Sewage Treatment PlantVSAPQGHGPTEQQRRAIRRNTILLSLVAFAIYVAFIASGVIKAQP*
Ga0075307_100232723300014260Natural And Restored WetlandsVRANKVSDGPTEEQRRGIRRTTILLALVALAIYVAFIASGVIKAQH*
Ga0075305_114145223300014295Natural And Restored WetlandsVSAHKVSDGPTEEQRRGIRRTTILLALVALAIYVAFIASGVIKAQH*
Ga0075341_100917723300014298Natural And Restored WetlandsVSDKQRNDGPTEEQRRGIRRTTILLVLVALAIYVAFIASGVMKAQH*
Ga0075350_106162323300014315Natural And Restored WetlandsVSDRQVNDGPTEEQRRGIRRTTIVLVLVALAIYVAFIASGVLKSQH*
Ga0075339_100808123300014316Natural And Restored WetlandsMNSQQTEEQRRRIRRTTIVLALVALAIYVAFIASGVMKAQP*
Ga0075348_122072013300014319Natural And Restored WetlandsVSDRQVNDGPTEEQRRGIRRTTIVLVLVALAIYVAFIASGVLKSQH
Ga0075355_117270923300014322Natural And Restored WetlandsMNGPNDEQRRGIRRTTILLVLVTLAIYFAFIASGVIKAQH*
Ga0180068_105274323300014864SoilVTGELPDDERRRRIRRNTVVLALIVLAIYVAFIASGVIKSQP*
Ga0180063_102594313300014885SoilQHDDQRRRIRRNTILLVLVALGIYVAFIASSVIGAQH*
Ga0163161_1210268123300017792Switchgrass RhizosphereVTGDPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP
Ga0190266_1011777323300017965SoilVTGELPDDERRRRIRRNTVVLALIALAIYVAFIASGVIKSQP
Ga0187787_1034520823300018029Tropical PeatlandSHLTPEQRRGIRRTTILLALVALAIYVAFIASGVIKSQH
Ga0184628_1032095623300018083Groundwater SedimentMSNGPTVEQRRRIRWTTLLLALTALGIYVAFIASAMLKAQR
Ga0184628_1065626813300018083Groundwater SedimentSDAQRRRNIRRNALVLALVALGIYVWFIASSVLSARP
Ga0190265_1092351323300018422SoilVTGEPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP
Ga0190272_1022289223300018429SoilVTSERPTVQRRRIRRNALLLALTALAIYVAFIVSGVIKAQP
Ga0190270_1135650823300018469SoilVTGELPDDERRRRIRRNTVVLALIVLAIYVAFIASGVIKSQP
Ga0190274_1033384933300018476SoilMAERDPTEEQRRRIRRTAIVLALVAIGIYVIFIASGVMKAQP
Ga0190271_1133874223300018481SoilMSGELSADERRRRIRRNTLVLALTALAIYVAFIVSGVIKAQS
Ga0210334_1025242623300021859EstuarineMAQHEPSAEQRRRVRRSAIVLAVVAIAIYVAFIASGVLGARG
Ga0224496_1008031123300022204SedimentMAMAQHEPTAEQRRRVRRSAIVLAVVAIAIYVAFIASGVLGARG
Ga0224500_10000916183300022213SedimentMTELDLAAEQRRRIRRTAIVLAVVAIAIYVAFIASGVMNAQP
Ga0224500_1009733713300022213SedimentEFDPAAEQRRRIRRTAIVLAVVAIAIYVAFIASGVMNAQP
Ga0224500_1010395723300022213SedimentMAEPTAEQRRRVRRSAIVLAVVALAIYVAFIASGVLGARG
Ga0224505_10000304183300022214SedimentMTEFDPAAEQRRRIRRTAIVLAVVAIAIYVAFIASGVMNAQP
Ga0224505_1002817813300022214SedimentSSKDAALQQMAERDPTAEQRRRIRRSAIVLAVVAIAIYAAFIASGVMKAQP
Ga0224506_1021847733300022221SedimentGPTDEQRRRIRRTTLVLALVALGIYVAFIASGVMQARQ
Ga0212091_1016735923300022549GroundwaterMAKRESSAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0247744_101281333300023073SoilVTGAPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP
Ga0124853_101095123300024056Freshwater WetlandsMTNGPTEQQRRRIRWTTVLLVLTALGIYVAFIASSVLKAQH
Ga0124853_143975033300024056Freshwater WetlandsMNSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP
Ga0124853_145564423300024056Freshwater WetlandsMAERDPTAEQRRRIRRSAIVLAVVALAIYVAFIASGVMKAQP
Ga0209398_100281233300025106GroundwaterVSEGRASTGTTAEQRRRIRRTTILLVLVALGIYVAFIASGVMKAQP
Ga0209594_1001371123300025130GroundwaterMQNGTSEEQRRRIRRTTVVLALVAVAIYVAFIASGVMKAQP
Ga0209594_100438523300025130GroundwaterMTEPTAEQRRRVRRSAIMLAVVAIAIYVAFIASGVFGARG
Ga0210098_104152523300025550Natural And Restored WetlandsVSANKVSDGPTEEQRRGIRRTTILLALVALAIYVAFIASGVIKAQH
Ga0210121_100329633300025555Natural And Restored WetlandsVNDGPTAEQRRGIRRTTIVLALVALAIYVAFIASGVIKSQH
Ga0207643_1047949823300025908Miscanthus RhizosphereVTGELPDDGRRRRIRRNTVVLALIALAIYVAFIASGVIKSQP
Ga0207650_1133731523300025925Switchgrass RhizosphereVTGELPDDGRRRRIRRNTVVLALIALAIYVAFIASGVIKSRP
Ga0210088_101965223300025948Natural And Restored WetlandsMDSQQTEEQRRRIRRTTIVLALVALAIYVAFIASGVMKAQP
Ga0210103_100953223300025968Natural And Restored WetlandsVSDKQPKDGPTEEQRRGIRRTTILLVLVALAIYAAFIASGVMKAQH
Ga0210091_101357423300025975Natural And Restored WetlandsMSDKDVAGGPTDEQRRSIRRTTILLSLVALAIYVAFIASGVIKAQH
Ga0210137_104591613300025980Natural And Restored WetlandsMSDKDVAGGPTDEQRRSIRRTTILLSLVALAIYVAFIASG
Ga0256805_101552323300026485SedimentVRGGAGTVEEGPNQEQRRGIRRTTLLLALVALAIYVAFIASGVIKSQH
Ga0209392_100478123300027683Freshwater SedimentMTERNPTVTAEQRRRVRRTAIVLAVVAIAIYVAFIASGVMSVRG
Ga0209392_106574023300027683Freshwater SedimentMAERDPTNEQRRRIRRTAIVLAVVAIGIYVAFIASGVMKAQP
Ga0209392_108824423300027683Freshwater SedimentMTAGGPSDEQRRRIRRTTIVLVIVALGIYVAFIASGVMKAQP
Ga0209704_111753323300027693Freshwater SedimentMTERNPTVTAEQRRRVRRTAIVLAVVAIAIYVAFIASGVMSARG
Ga0208665_1000699233300027715Deep SubsurfaceMSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0209682_1000630133300027716Wetland SedimentMNSQQTDEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0209492_130828223300027721Freshwater SedimentMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0209464_1008366233300027778Wetland SedimentVSDKNVTGGPTDEQRRSIRRTTILLALVALAIYVAFIASGVMKAQH
Ga0209464_1025356223300027778Wetland SedimentMSNGPTEEQRRRIRWTTILLALTAIGIYVAFIASAMTKAQH
Ga0209464_1038065823300027778Wetland SedimentDEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0209373_1031446823300027796FreshwaterMAQGSQTAEQRRRIRRTAILLGVVALAIYVAFIASGVMKAQP
Ga0209476_1033104713300027802Activated SludgeMAERDPTAEQRRRIRRSAIVLALVAIAVYVAFIASGL
Ga0209797_1003744533300027831Wetland SedimentMTELDPAAEQRRRIRRTAIVLAAVAIAIYVAFIASGVMKAQP
Ga0209262_1002148813300027841FreshwaterPTDEQRRRIRRTALVLALVALGIYVAFIASGVMRAQG
Ga0209262_1011010623300027841FreshwaterMALQEMAEREPTAEQRRRIRRSAIVLALIAIAVYVAFIASGVMKAQP
Ga0209262_1017921723300027841FreshwaterMNSQQTDEQRRRIRRTTIVLALVALAIYVAFIASGVMKAQH
Ga0209262_1020866423300027841FreshwaterMSSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP
Ga0209262_1045860413300027841FreshwaterDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0209397_1063738613300027871WetlandTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0209293_1036489723300027877WetlandMNAGRSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP
Ga0209450_1002003173300027885Freshwater Lake SedimentMTGGPTSEQRRRIRWTTVLLVLTALGIYVAFIASSVLKAQH
Ga0209450_1004071753300027885Freshwater Lake SedimentMAQDSQTAEQRRRIRRTAILLGVVALAIYVAFIASGVMKAQP
Ga0209450_1011397113300027885Freshwater Lake SedimentALNEMAERDPTEEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0209450_1028571233300027885Freshwater Lake SedimentERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0209450_1047131623300027885Freshwater Lake SedimentMSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQH
Ga0208980_1000559523300027887WetlandVNDGPTDEQRRGIRRTAILLALVALAIYVAFIASGVMKAQH
Ga0209496_1014496913300027890WetlandGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQH
Ga0209496_1033339823300027890WetlandMALQDMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQS
Ga0209254_1023063123300027897Freshwater Lake SedimentMNGQQTEEQRRRIRRTTIVLALVALGIYMAFIASGVMKAQP
Ga0209668_1008775723300027899Freshwater Lake SedimentMNPGPTSEQRRRIRWTTVVLALIAIGIYVAFIASSVIKARH
Ga0209668_1013195123300027899Freshwater Lake SedimentMAERDPTEEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0209668_1013417433300027899Freshwater Lake SedimentVSGSEVTSNGPTEEQRRAIRRSTIVLVLVALVIYVAFIASGVMKAQP
Ga0209668_1015954923300027899Freshwater Lake SedimentMTGARMTNGPTEQQRRRIRWTTVLLVLTALGIYVAFIASSVLKAQH
Ga0209668_1021973023300027899Freshwater Lake SedimentMAERDQTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0209668_1022262333300027899Freshwater Lake SedimentVNDGPTDKQRRAIRRTAILLALVALAIYVAFIASGVMKAQH
Ga0209668_1035364623300027899Freshwater Lake SedimentMGSQQTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0209668_1041952323300027899Freshwater Lake SedimentMAERDPTAEQRRRIRRTAIVLAVVAIAIYVAFIASGVMKAQP
Ga0209253_10007747133300027900Freshwater Lake SedimentMATRMSNGPTEQQRRRIRWTTIVLALTAIGIYVAFIASAMMKSQH
Ga0209253_1037631933300027900Freshwater Lake SedimentMSQGRTVEQRRRIRWTTVLLVLTALGIYVAFIASSVLKAPH
Ga0209253_1062324123300027900Freshwater Lake SedimentMAQGTQTAEQRRRIRRTAILLGVVALAIYVAFIASGVMKAQP
Ga0209253_1087655413300027900Freshwater Lake SedimentQTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0209048_1001003653300027902Freshwater Lake SedimentMRSGPTDEQRRRIRWTTVLLALAALGIYVAFIASSVMKARH
Ga0209048_1007305733300027902Freshwater Lake SedimentMSHGPTEEQRRRIRWTTLVLALTALGIYFAFIASAMMKAPHP
Ga0209382_1009212723300027909Populus RhizosphereVTGDLSEEERRRRIRRSSVILALVALAIYVAFIASGVLKS
Ga0209536_10101757623300027917Marine SedimentMSSGPTDEQRRRIRRNSIVLALTALAIYVTFIVSGMLRVPN
Ga0209079_1000585663300027972Freshwater SedimentMTEQDPSLAQRRRIRRTALLLAAVALAIYVAFIASGVMKAQG
Ga0209079_1019473823300027972Freshwater SedimentMTEHDPTDAQRRRIRRTAFLLAAVALAIYVAFIASGVMKAQG
Ga0272412_108245713300028647Activated SludgeMTQDTRDEERRRRDIRRTTVLLVLVALGIYVAFIASGVMQARP
Ga0299906_1003397633300030606SoilVIGGRPTEQRRRIRRNTLLLALTALAIYVAFIVSGVIKAQP
Ga0268386_1000002653300030619SoilVTGELPEDERRRRIRRNTVVLALIAIAIYVAFIASGVIKSQA
Ga0316575_1005391533300031665RhizosphereMSRGPGDDERRRIRRTAILLALTALGIYVAFIASGIMKAQP
Ga0315288_1034887633300031772SedimentMAERGPTAEQRRRIRRSAIVLAVVAITIYVAFIASGVMKAQP
Ga0315290_1009938333300031834SedimentMAERDPTAEQRRRIRRSAIVLAVVAIGIYVAFIASGVMKAQP
Ga0315290_1022324223300031834SedimentVSGNDVSNGPTDEQKRGIRRTTILLALVALAIYVAFIASGVMKARH
Ga0315290_1024589123300031834SedimentMAQDSQTAEQRRRIRRAAILLGVVALAIYVAFIASGVMKAQP
Ga0315290_1034131333300031834SedimentMSNGPTEQQRRRIRWTTILLALTAIGIYVAFIASAMMKSQH
Ga0315290_1034188713300031834SedimentMNLGPTSEQRRRIRWTTVVLALIAIGIYVAFIASSVIKARP
Ga0315909_1094237223300031857FreshwaterVTAAPMNSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP
Ga0315297_1000868723300031873SedimentMSQGPTAEQRRRIRRTTVLLALTALGIYVAFIASSVLKAPH
Ga0315297_1043304523300031873SedimentVSGNDVTNGPTDQQKRGIRRTTILLALVALAIYVAFIASGVMKAQH
Ga0315297_1061343123300031873SedimentMNTGLTDEQRRRIRRTAILLALVALGIYAAFIASGVIKAQH
Ga0310901_1000197953300031940SoilVTGDPNDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP
Ga0315278_1061432423300031997SedimentMAERGPTAEQRRRIRRSAIVLAVVAITIYVAFIASGVMSAQP
Ga0315905_1117889823300032092FreshwaterMAQHEPTAEQRRRVRRSAIVLAVVAIAIYAAFIASGVLGARG
Ga0315292_1076308723300032143SedimentVTAAPMNRQQTDEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0315295_1161507523300032156SedimentMSNGPTEQQRRRIRWTTIVLALTAIGIYVAFIASAMMKSQH
Ga0315283_1187869223300032164SedimentMNSQQTDAQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0315276_1112084633300032177SedimentNDVTNGPTDQQKRGIRRTTILLALVALAIYVAFIASGVMKAQH
Ga0307471_10387677923300032180Hardwood Forest SoilVSDDASSERRRRIRRNSVVLALVAAAIYVGFIVSGVIRAQH
Ga0315271_1064772823300032256SedimentMNPGPTSEQRRRIRWSAIVLALIAIGIYVAFIASSVIKARH
Ga0315271_1090107223300032256SedimentMSNGPTDEQRRRIRWTTLVLALVALGIYVAFIASAMMKAQP
Ga0315271_1152620223300032256SedimentQVTAAPMNSQQTDEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0315286_1172026523300032342SedimentVTAAPMNSQQTDEQRRRIRRTTIVLALVALGIYAAFIASGVMKAQP
Ga0315287_10003671113300032397SedimentMNSQQTEERRRRIRRTTIVLALVALGIYAAFIASGVMKAQP
Ga0315287_1050117923300032397SedimentMNPGPTSEQRRRIRWTAVVLALIAIGIYVAFIASSVIKARH
Ga0315287_1107996823300032397SedimentMNGQQTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0315287_1108786623300032397SedimentMSSQQTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP
Ga0315287_1246314723300032397SedimentVSVSEVTRNGPTEEQRRAIRRSTIVLVLVALAIYVAFIASGVMKAQP
Ga0335084_1151765523300033004SoilVRGGAGTVDQGPNQEQRRGIRRTTLLLALVALAIYVAFIASGVIKSQH
Ga0316604_1051271323300033406SoilMDSQQTEQQRRRIRRTTIVLALVALGIYVAFIASGMMKAMP
Ga0316604_1079891323300033406SoilMNAGQTDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP
Ga0316604_1083738513300033406SoilSKGMALQDMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0316605_1066692023300033408SoilVSGEHVNQGPTDRQRRRIRRTTILLALVALGIYVAFIASGVMKAQP
Ga0316605_1142601323300033408SoilMQNGISEEQRRRIRRTTVVLALVALAIYVAFIASGVMKAQP
Ga0316605_1143466913300033408SoilNGISEEQRRRIRRTTVVLALVALAIYVAFIASGVMKAQP
Ga0316605_1149693123300033408SoilMALQDMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP
Ga0316605_1215181823300033408SoilMNQGGPLDEQRRRNVRWTAIVLALIALGIYVAFIASSVMKAQH
Ga0316605_1234916513300033408SoilMALQEMAEREPTAEQRRRIRRSAIVLALVAIAVYVAFIASGVMKAQS
Ga0316605_1243378523300033408SoilVPASNDMAEHEPTSEQRRRIRRTAIVLAVVAIAIYVAFIASGVMKAQP
Ga0316603_1042167933300033413SoilMALQEMAEREPTAEQRRRIRRSAIVLALVVIAVYVAFIASGVMKAQS
Ga0316603_1058295633300033413SoilPGPTDRQRRRIRRTTILLALVALGIYVAFIASGVMKAQP
Ga0316603_1071884923300033413SoilMNAGPSDEQRRRIRRTTVVLVLVALGIYVAFIASSMMKAQP
Ga0316603_1225598713300033413SoilEHEPTSEQRRRIRRTAIVLAVVAIAIYVAFIASGVMKAQP
Ga0316619_1058476423300033414SoilMNAGPTDEQRRRIRRTTILLALVALGIYVAFIASGVMKAQP
Ga0316619_1061218223300033414SoilVSGKQVNDGPTDEQRRGIRRTTIVLALVALAIYVAFIASGVIKSQH
Ga0316625_10039646123300033418SoilVSAKPVNEGQSEQQRRAIRRTTILLVLVALGIYVAFIASGVIKAQH
Ga0316625_10142642123300033418SoilVSAPEGHGPTEQQRRAIRRNTILLSLVALAIYVAFIASGVIKAQP
Ga0316625_10243652013300033418SoilMDSQQTEQQRRRIRRTTIALALVALGIYVAFIASGMMKAMS
Ga0316601_10059957423300033419SoilMNAGPSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP
Ga0316601_10115648823300033419SoilMALQEMAEREPTAEQRRRIRRSAIVLALIAIAVYVAFIASGVMKAQS
Ga0316613_1010897513300033434SoilPTAEQRRRIRRSAIVLALVAIAVYVAFIASGVMKAQS
Ga0316627_10012764213300033482SoilGRQVRNRAMNAGPSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP
Ga0316627_10052856923300033482SoilVSGGHVNTGPTDEQRRRIRRTTIVLALVALGIYVAFIVSGVMKAQP
Ga0316629_1131637313300033483SoilNPGPTDRQRRRIRRTTILLALVALGIYVAFIASGVMKAQP
Ga0316626_1023267323300033485SoilMDSQQTEQQRRRIRRTTIVLALVALGIYVAFIASGMMKATP
Ga0316626_1037036313300033485SoilPALQDMAERDPTAEQRRRIRRSAIVLAVVALAIYVAFIASGVMKAQP
Ga0316630_1002127713300033487SoilMSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQ
Ga0373889_010515_158_2803300034052Sediment SlurryMTEPTAEQRRRVRRSAIVLGVVAIAIYVAFIMSGVLGARG
Ga0373889_021643_621_7493300034052Sediment SlurryMTEHDPIEAQRRRIRRTALLLAAVALAIYVAFIASGVMKAQG
Ga0373891_033730_486_6143300034054Sediment SlurryMAEHDTTEEQRRRIRRSALVLAVVAIAIYVAFIASGVMKAQP
Ga0370490_0022335_401_5293300034128Untreated Peat SoilMAERDPTNEQRRRIRRSAIVLAVVAIAIYAAFIASGVMKAQP
Ga0364927_0116407_169_2973300034148SedimentVTRELPDDERRRRIRRNTVVLALIALAIYVAFIASGVIKSQP
Ga0364929_0261250_26_1543300034149SedimentVTGELPDDERRRRIRRNTMVLALIALAIYVAFIASGVIKSQP
Ga0364929_0267749_474_5783300034149SedimentVTGELPDDERRRRIRRNTMVLALIALAIYVAFIAS
Ga0364933_168268_391_5193300034150SedimentVTGELPDDERRRRIRRNTVVLALIALAIYVAFIASGVIKSHT
Ga0364935_0017066_93_2213300034151SedimentVTGELPDVERRRRIRRNTVVLALIALAIYVAFIASGVIKSQP
Ga0370480_0004625_4048_41763300034169Untreated Peat SoilMAERDPTSEQRRRIRRSAIVLAVIAVAIYAAFIASGVMKAQP
Ga0364931_0014685_1359_14843300034176SedimentVTGERPTEQRRRIRRNTLLLALTALAIYVAFIVSGVIKAQP
Ga0370499_0203000_48_1733300034194Untreated Peat SoilVTTGPTDEQRRRIRRTTVVLALVALGIYVAFIASGVMQARG
Ga0370503_0229346_161_2893300034196Untreated Peat SoilMADRDPSAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKSQP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.