Basic Information | |
---|---|
Family ID | F013428 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 271 |
Average Sequence Length | 42 residues |
Representative Sequence | MSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP |
Number of Associated Samples | 168 |
Number of Associated Scaffolds | 271 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 60.52 % |
% of genes near scaffold ends (potentially truncated) | 15.87 % |
% of genes from short scaffolds (< 2000 bps) | 78.60 % |
Associated GOLD sequencing projects | 147 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.192 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (10.701 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.985 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (26.199 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 271 Family Scaffolds |
---|---|---|
PF00115 | COX1 | 36.53 |
PF04442 | CtaG_Cox11 | 33.95 |
PF00510 | COX3 | 9.96 |
PF02104 | SURF1 | 2.58 |
PF11137 | DUF2909 | 1.48 |
PF13500 | AAA_26 | 1.11 |
PF02790 | COX2_TM | 1.11 |
PF03334 | PhaG_MnhG_YufB | 0.74 |
PF01040 | UbiA | 0.74 |
PF00116 | COX2 | 0.37 |
PF07715 | Plug | 0.37 |
PF01979 | Amidohydro_1 | 0.37 |
PF11104 | PilM_2 | 0.37 |
PF02628 | COX15-CtaA | 0.37 |
PF02386 | TrkH | 0.37 |
PF06968 | BATS | 0.37 |
PF10003 | DUF2244 | 0.37 |
PF00155 | Aminotran_1_2 | 0.37 |
COG ID | Name | Functional Category | % Frequency in 271 Family Scaffolds |
---|---|---|---|
COG3175 | Cytochrome c oxidase assembly protein Cox11 | Posttranslational modification, protein turnover, chaperones [O] | 33.95 |
COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 9.96 |
COG3346 | Cytochrome oxidase assembly protein ShyY1 | Posttranslational modification, protein turnover, chaperones [O] | 2.58 |
COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 1.48 |
COG1320 | Multisubunit Na+/H+ antiporter, MnhG subunit | Inorganic ion transport and metabolism [P] | 0.74 |
COG0168 | Trk-type K+ transport system, membrane component | Inorganic ion transport and metabolism [P] | 0.37 |
COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.37 |
COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 0.37 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.30 % |
Unclassified | root | N/A | 10.70 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000124|BS_KBA_SWE12_21mDRAFT_c10111802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 665 | Open in IMG/M |
3300000134|BS_KBA_SWE07_21mDRAFT_c1027979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
3300001213|JGIcombinedJ13530_104913655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 544 | Open in IMG/M |
3300002961|JGI11641J44799_10035823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1453 | Open in IMG/M |
3300003371|JGI26145J50221_1022593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
3300003432|JGI20214J51088_10271773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1169 | Open in IMG/M |
3300003858|Ga0031656_10012264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3591 | Open in IMG/M |
3300003858|Ga0031656_10044944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1775 | Open in IMG/M |
3300003858|Ga0031656_10093091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1109 | Open in IMG/M |
3300003859|Ga0031653_10036790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1352 | Open in IMG/M |
3300003861|Ga0031654_10009990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2791 | Open in IMG/M |
3300003991|Ga0055461_10132445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 647 | Open in IMG/M |
3300004048|Ga0055494_10079373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 681 | Open in IMG/M |
3300004050|Ga0055491_10107037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 698 | Open in IMG/M |
3300004151|Ga0066602_10415465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 606 | Open in IMG/M |
3300004154|Ga0066603_10491888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 577 | Open in IMG/M |
3300004155|Ga0066600_10278718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 754 | Open in IMG/M |
3300004155|Ga0066600_10679292 | Not Available | 521 | Open in IMG/M |
3300004155|Ga0066600_10740511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 502 | Open in IMG/M |
3300004156|Ga0062589_100044654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2420 | Open in IMG/M |
3300004156|Ga0062589_100724234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 887 | Open in IMG/M |
3300004463|Ga0063356_105829883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 528 | Open in IMG/M |
3300004481|Ga0069718_10085624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1217 | Open in IMG/M |
3300004643|Ga0062591_102563126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 537 | Open in IMG/M |
3300004778|Ga0062383_10111371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1184 | Open in IMG/M |
3300004778|Ga0062383_10295106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 776 | Open in IMG/M |
3300004779|Ga0062380_10275635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 704 | Open in IMG/M |
3300004781|Ga0062379_10032897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 970 | Open in IMG/M |
3300004808|Ga0062381_10124331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 833 | Open in IMG/M |
3300005328|Ga0070676_10087857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1898 | Open in IMG/M |
3300005331|Ga0070670_102073828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 524 | Open in IMG/M |
3300005354|Ga0070675_100773321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 877 | Open in IMG/M |
3300005655|Ga0073905_10425820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 559 | Open in IMG/M |
3300005827|Ga0074478_1329118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1945 | Open in IMG/M |
3300005829|Ga0074479_10189993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1587 | Open in IMG/M |
3300005833|Ga0074472_10078306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 883 | Open in IMG/M |
3300005833|Ga0074472_10892568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
3300005836|Ga0074470_10665608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 672 | Open in IMG/M |
3300005940|Ga0073913_10059132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 620 | Open in IMG/M |
3300006040|Ga0073914_10033537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 917 | Open in IMG/M |
3300006092|Ga0082021_1004426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5826 | Open in IMG/M |
3300006092|Ga0082021_1114038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 30466 | Open in IMG/M |
3300006092|Ga0082021_1172796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 88926 | Open in IMG/M |
3300006224|Ga0079037_100040736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3541 | Open in IMG/M |
3300006224|Ga0079037_100042017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3498 | Open in IMG/M |
3300006224|Ga0079037_100198666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1798 | Open in IMG/M |
3300006224|Ga0079037_100392177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1312 | Open in IMG/M |
3300006224|Ga0079037_100437291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1245 | Open in IMG/M |
3300006224|Ga0079037_100744503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 959 | Open in IMG/M |
3300006224|Ga0079037_101166305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 765 | Open in IMG/M |
3300006224|Ga0079037_101254469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 737 | Open in IMG/M |
3300006224|Ga0079037_101257766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 736 | Open in IMG/M |
3300006224|Ga0079037_101319998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 718 | Open in IMG/M |
3300006224|Ga0079037_101848719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 603 | Open in IMG/M |
3300006606|Ga0074062_11581630 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
3300006844|Ga0075428_100062316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4083 | Open in IMG/M |
3300006844|Ga0075428_100447336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1384 | Open in IMG/M |
3300006845|Ga0075421_100393697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1665 | Open in IMG/M |
3300006930|Ga0079303_10027349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1890 | Open in IMG/M |
3300006930|Ga0079303_10488034 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
3300009009|Ga0105105_10256248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 929 | Open in IMG/M |
3300009009|Ga0105105_10472723 | Not Available | 712 | Open in IMG/M |
3300009009|Ga0105105_10532759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 676 | Open in IMG/M |
3300009068|Ga0114973_10000019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 98836 | Open in IMG/M |
3300009075|Ga0105090_10000525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 18982 | Open in IMG/M |
3300009075|Ga0105090_10022280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 3903 | Open in IMG/M |
3300009075|Ga0105090_10096472 | Not Available | 1851 | Open in IMG/M |
3300009078|Ga0105106_10666458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 744 | Open in IMG/M |
3300009091|Ga0102851_11067754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
3300009091|Ga0102851_12991098 | Not Available | 543 | Open in IMG/M |
3300009091|Ga0102851_13411396 | Not Available | 510 | Open in IMG/M |
3300009111|Ga0115026_11405490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 577 | Open in IMG/M |
3300009120|Ga0117941_1081970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1408 | Open in IMG/M |
3300009131|Ga0115027_11060021 | Not Available | 639 | Open in IMG/M |
3300009147|Ga0114129_13047080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 549 | Open in IMG/M |
3300009156|Ga0111538_10416659 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
3300009156|Ga0111538_13261806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 565 | Open in IMG/M |
3300009165|Ga0105102_10143455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1158 | Open in IMG/M |
3300009167|Ga0113563_10041615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3789 | Open in IMG/M |
3300009167|Ga0113563_10090101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2772 | Open in IMG/M |
3300009167|Ga0113563_11023990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 952 | Open in IMG/M |
3300009167|Ga0113563_13196780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 555 | Open in IMG/M |
3300009169|Ga0105097_10248610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
3300009455|Ga0114939_10000426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 35429 | Open in IMG/M |
3300009455|Ga0114939_10007899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 6034 | Open in IMG/M |
3300009455|Ga0114939_10040485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2046 | Open in IMG/M |
3300009506|Ga0118657_10004961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 21765 | Open in IMG/M |
3300009506|Ga0118657_10064030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5557 | Open in IMG/M |
3300009506|Ga0118657_11366540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 843 | Open in IMG/M |
3300009509|Ga0123573_10177595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2114 | Open in IMG/M |
3300009509|Ga0123573_10339258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1449 | Open in IMG/M |
3300009527|Ga0114942_1160911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 789 | Open in IMG/M |
3300009540|Ga0073899_11127926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 548 | Open in IMG/M |
3300009609|Ga0105347_1263456 | Not Available | 712 | Open in IMG/M |
3300009610|Ga0105340_1213391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 816 | Open in IMG/M |
3300009693|Ga0116141_10452688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
3300009868|Ga0130016_10219000 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1417 | Open in IMG/M |
3300009868|Ga0130016_10566050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 714 | Open in IMG/M |
3300009870|Ga0131092_10101096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3400 | Open in IMG/M |
3300009870|Ga0131092_10713261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
3300009870|Ga0131092_10898432 | Not Available | 728 | Open in IMG/M |
3300010400|Ga0134122_10274599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1435 | Open in IMG/M |
3300010412|Ga0136852_10006154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 13335 | Open in IMG/M |
3300010997|Ga0139324_1004183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 2180 | Open in IMG/M |
3300012990|Ga0159060_1143096 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 669 | Open in IMG/M |
3300013769|Ga0119887_1001660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 8764 | Open in IMG/M |
3300013769|Ga0119887_1002210 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7296 | Open in IMG/M |
3300014260|Ga0075307_1002327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2894 | Open in IMG/M |
3300014295|Ga0075305_1141452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
3300014298|Ga0075341_1009177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1198 | Open in IMG/M |
3300014315|Ga0075350_1061623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 826 | Open in IMG/M |
3300014316|Ga0075339_1008081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2314 | Open in IMG/M |
3300014319|Ga0075348_1220720 | Not Available | 532 | Open in IMG/M |
3300014322|Ga0075355_1172709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 587 | Open in IMG/M |
3300014864|Ga0180068_1052743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 670 | Open in IMG/M |
3300014885|Ga0180063_1025943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1619 | Open in IMG/M |
3300017792|Ga0163161_12102681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 502 | Open in IMG/M |
3300017965|Ga0190266_10117773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1129 | Open in IMG/M |
3300018029|Ga0187787_10345208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 572 | Open in IMG/M |
3300018083|Ga0184628_10320956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 813 | Open in IMG/M |
3300018083|Ga0184628_10656268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 526 | Open in IMG/M |
3300018422|Ga0190265_10923513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 995 | Open in IMG/M |
3300018429|Ga0190272_10222892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1387 | Open in IMG/M |
3300018469|Ga0190270_11356508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 756 | Open in IMG/M |
3300018476|Ga0190274_10333849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1432 | Open in IMG/M |
3300018481|Ga0190271_11338742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 836 | Open in IMG/M |
3300021859|Ga0210334_10252426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
3300022204|Ga0224496_10080311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1440 | Open in IMG/M |
3300022213|Ga0224500_10000916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 18459 | Open in IMG/M |
3300022213|Ga0224500_10097337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1124 | Open in IMG/M |
3300022213|Ga0224500_10103957 | Not Available | 1082 | Open in IMG/M |
3300022214|Ga0224505_10000304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 34253 | Open in IMG/M |
3300022214|Ga0224505_10028178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2454 | Open in IMG/M |
3300022221|Ga0224506_10218477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 875 | Open in IMG/M |
3300022549|Ga0212091_10167359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 876 | Open in IMG/M |
3300023073|Ga0247744_1012813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1134 | Open in IMG/M |
3300024056|Ga0124853_1010951 | Not Available | 1922 | Open in IMG/M |
3300024056|Ga0124853_1439750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2523 | Open in IMG/M |
3300024056|Ga0124853_1455644 | Not Available | 1908 | Open in IMG/M |
3300025106|Ga0209398_1002812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 7639 | Open in IMG/M |
3300025130|Ga0209594_1001371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 12232 | Open in IMG/M |
3300025130|Ga0209594_1004385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 6345 | Open in IMG/M |
3300025550|Ga0210098_1041525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 734 | Open in IMG/M |
3300025555|Ga0210121_1003296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3173 | Open in IMG/M |
3300025908|Ga0207643_10479498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 794 | Open in IMG/M |
3300025925|Ga0207650_11337315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 610 | Open in IMG/M |
3300025948|Ga0210088_1019652 | Not Available | 1017 | Open in IMG/M |
3300025968|Ga0210103_1009532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1732 | Open in IMG/M |
3300025975|Ga0210091_1013574 | Not Available | 782 | Open in IMG/M |
3300025980|Ga0210137_1045916 | Not Available | 637 | Open in IMG/M |
3300026485|Ga0256805_1015523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
3300027683|Ga0209392_1004781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3899 | Open in IMG/M |
3300027683|Ga0209392_1065740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1172 | Open in IMG/M |
3300027683|Ga0209392_1088244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 992 | Open in IMG/M |
3300027693|Ga0209704_1117533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 762 | Open in IMG/M |
3300027715|Ga0208665_10006992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2632 | Open in IMG/M |
3300027716|Ga0209682_10006301 | All Organisms → cellular organisms → Bacteria | 3116 | Open in IMG/M |
3300027721|Ga0209492_1308282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
3300027778|Ga0209464_10083662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1080 | Open in IMG/M |
3300027778|Ga0209464_10253562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 635 | Open in IMG/M |
3300027778|Ga0209464_10380658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 519 | Open in IMG/M |
3300027796|Ga0209373_10314468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 635 | Open in IMG/M |
3300027802|Ga0209476_10331047 | Not Available | 656 | Open in IMG/M |
3300027831|Ga0209797_10037445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2188 | Open in IMG/M |
3300027841|Ga0209262_10021488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2743 | Open in IMG/M |
3300027841|Ga0209262_10110106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1300 | Open in IMG/M |
3300027841|Ga0209262_10179217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1021 | Open in IMG/M |
3300027841|Ga0209262_10208664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 946 | Open in IMG/M |
3300027841|Ga0209262_10458604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 621 | Open in IMG/M |
3300027871|Ga0209397_10637386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 534 | Open in IMG/M |
3300027877|Ga0209293_10364897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 743 | Open in IMG/M |
3300027885|Ga0209450_10020031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3772 | Open in IMG/M |
3300027885|Ga0209450_10040717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2808 | Open in IMG/M |
3300027885|Ga0209450_10113971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1816 | Open in IMG/M |
3300027885|Ga0209450_10285712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1189 | Open in IMG/M |
3300027885|Ga0209450_10471316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 919 | Open in IMG/M |
3300027887|Ga0208980_10005595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 7533 | Open in IMG/M |
3300027890|Ga0209496_10144969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1078 | Open in IMG/M |
3300027890|Ga0209496_10333398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 770 | Open in IMG/M |
3300027897|Ga0209254_10230631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1459 | Open in IMG/M |
3300027899|Ga0209668_10087757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1780 | Open in IMG/M |
3300027899|Ga0209668_10131951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1494 | Open in IMG/M |
3300027899|Ga0209668_10134174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1483 | Open in IMG/M |
3300027899|Ga0209668_10159549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1375 | Open in IMG/M |
3300027899|Ga0209668_10219730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1191 | Open in IMG/M |
3300027899|Ga0209668_10222623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1184 | Open in IMG/M |
3300027899|Ga0209668_10353646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 954 | Open in IMG/M |
3300027899|Ga0209668_10419523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 878 | Open in IMG/M |
3300027900|Ga0209253_10007747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9257 | Open in IMG/M |
3300027900|Ga0209253_10376319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1084 | Open in IMG/M |
3300027900|Ga0209253_10623241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 788 | Open in IMG/M |
3300027900|Ga0209253_10876554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 631 | Open in IMG/M |
3300027902|Ga0209048_10010036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 8531 | Open in IMG/M |
3300027902|Ga0209048_10073057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 2712 | Open in IMG/M |
3300027909|Ga0209382_10092127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3560 | Open in IMG/M |
3300027917|Ga0209536_101017576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 1021 | Open in IMG/M |
3300027972|Ga0209079_10005856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4232 | Open in IMG/M |
3300027972|Ga0209079_10194738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 693 | Open in IMG/M |
3300028647|Ga0272412_1082457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1370 | Open in IMG/M |
3300030606|Ga0299906_10033976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4075 | Open in IMG/M |
3300030619|Ga0268386_10000026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 70554 | Open in IMG/M |
3300031665|Ga0316575_10053915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1601 | Open in IMG/M |
3300031772|Ga0315288_10348876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales | 1523 | Open in IMG/M |
3300031834|Ga0315290_10099383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2450 | Open in IMG/M |
3300031834|Ga0315290_10223242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1641 | Open in IMG/M |
3300031834|Ga0315290_10245891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1561 | Open in IMG/M |
3300031834|Ga0315290_10341313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1312 | Open in IMG/M |
3300031834|Ga0315290_10341887 | All Organisms → cellular organisms → Eukaryota | 1311 | Open in IMG/M |
3300031857|Ga0315909_10942372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 528 | Open in IMG/M |
3300031873|Ga0315297_10008687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6851 | Open in IMG/M |
3300031873|Ga0315297_10433045 | Not Available | 1104 | Open in IMG/M |
3300031873|Ga0315297_10613431 | Not Available | 913 | Open in IMG/M |
3300031940|Ga0310901_10001979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4583 | Open in IMG/M |
3300031997|Ga0315278_10614324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1112 | Open in IMG/M |
3300032092|Ga0315905_11178898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 627 | Open in IMG/M |
3300032143|Ga0315292_10763087 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 811 | Open in IMG/M |
3300032156|Ga0315295_11615075 | Not Available | 621 | Open in IMG/M |
3300032164|Ga0315283_11878692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 600 | Open in IMG/M |
3300032177|Ga0315276_11120846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 832 | Open in IMG/M |
3300032180|Ga0307471_103876779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 529 | Open in IMG/M |
3300032256|Ga0315271_10647728 | Not Available | 905 | Open in IMG/M |
3300032256|Ga0315271_10901072 | Not Available | 763 | Open in IMG/M |
3300032256|Ga0315271_11526202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 575 | Open in IMG/M |
3300032342|Ga0315286_11720265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
3300032397|Ga0315287_10003671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 14828 | Open in IMG/M |
3300032397|Ga0315287_10501179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1441 | Open in IMG/M |
3300032397|Ga0315287_11079968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 930 | Open in IMG/M |
3300032397|Ga0315287_11087866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 926 | Open in IMG/M |
3300032397|Ga0315287_12463147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 560 | Open in IMG/M |
3300033004|Ga0335084_11517655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 662 | Open in IMG/M |
3300033406|Ga0316604_10512713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 659 | Open in IMG/M |
3300033406|Ga0316604_10798913 | Not Available | 518 | Open in IMG/M |
3300033406|Ga0316604_10837385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 505 | Open in IMG/M |
3300033408|Ga0316605_10666920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 978 | Open in IMG/M |
3300033408|Ga0316605_11426013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 671 | Open in IMG/M |
3300033408|Ga0316605_11434669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 669 | Open in IMG/M |
3300033408|Ga0316605_11496931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
3300033408|Ga0316605_12151818 | Not Available | 543 | Open in IMG/M |
3300033408|Ga0316605_12349165 | Not Available | 518 | Open in IMG/M |
3300033408|Ga0316605_12433785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 509 | Open in IMG/M |
3300033413|Ga0316603_10421679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1210 | Open in IMG/M |
3300033413|Ga0316603_10582956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1036 | Open in IMG/M |
3300033413|Ga0316603_10718849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 934 | Open in IMG/M |
3300033413|Ga0316603_12255987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 513 | Open in IMG/M |
3300033414|Ga0316619_10584764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 925 | Open in IMG/M |
3300033414|Ga0316619_10612182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 907 | Open in IMG/M |
3300033418|Ga0316625_100396461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1039 | Open in IMG/M |
3300033418|Ga0316625_101426421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
3300033418|Ga0316625_102436520 | Not Available | 527 | Open in IMG/M |
3300033419|Ga0316601_100599574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1070 | Open in IMG/M |
3300033419|Ga0316601_101156488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 775 | Open in IMG/M |
3300033434|Ga0316613_10108975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1700 | Open in IMG/M |
3300033482|Ga0316627_100127642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1817 | Open in IMG/M |
3300033482|Ga0316627_100528569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1055 | Open in IMG/M |
3300033483|Ga0316629_11316373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 582 | Open in IMG/M |
3300033485|Ga0316626_10232673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1467 | Open in IMG/M |
3300033485|Ga0316626_10370363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1188 | Open in IMG/M |
3300033487|Ga0316630_10021277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3536 | Open in IMG/M |
3300034052|Ga0373889_010515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1259 | Open in IMG/M |
3300034052|Ga0373889_021643 | Not Available | 929 | Open in IMG/M |
3300034054|Ga0373891_033730 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 785 | Open in IMG/M |
3300034128|Ga0370490_0022335 | All Organisms → cellular organisms → Bacteria | 2117 | Open in IMG/M |
3300034148|Ga0364927_0116407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 752 | Open in IMG/M |
3300034149|Ga0364929_0261250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 584 | Open in IMG/M |
3300034149|Ga0364929_0267749 | Not Available | 578 | Open in IMG/M |
3300034150|Ga0364933_168268 | Not Available | 570 | Open in IMG/M |
3300034151|Ga0364935_0017066 | All Organisms → cellular organisms → Bacteria | 1922 | Open in IMG/M |
3300034169|Ga0370480_0004625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 5057 | Open in IMG/M |
3300034176|Ga0364931_0014685 | All Organisms → cellular organisms → Bacteria | 2130 | Open in IMG/M |
3300034194|Ga0370499_0203000 | Not Available | 533 | Open in IMG/M |
3300034196|Ga0370503_0229346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 666 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.70% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 9.23% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.49% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 7.75% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.90% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 4.06% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.32% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 3.69% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 2.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.95% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 2.58% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.58% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.58% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 2.21% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.21% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.85% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.48% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.48% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.48% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.48% |
Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 1.11% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 1.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.11% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.11% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.11% |
Wastewater Treatment Plant | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant | 1.11% |
Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.11% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.74% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.74% |
Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.74% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.74% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.74% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.74% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.74% |
Sewage Treatment Plant | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant | 0.74% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.37% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.37% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.37% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.37% |
Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 0.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.37% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.37% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.37% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.37% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.37% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.37% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.37% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.37% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
3300000134 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 07_21m | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Host-Associated | Open in IMG/M |
3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004048 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 | Environmental | Open in IMG/M |
3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
3300004151 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 | Environmental | Open in IMG/M |
3300004154 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 | Environmental | Open in IMG/M |
3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300004781 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh | Environmental | Open in IMG/M |
3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005655 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_supernatant | Engineered | Open in IMG/M |
3300005827 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300006040 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_30-Apr-14 | Environmental | Open in IMG/M |
3300006092 | Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore | Engineered | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009120 | Lake sediment microbial communities from Tanners Lake, St. Paul, MN | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
3300009540 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph | Engineered | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
3300010997 | ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) | Environmental | Open in IMG/M |
3300012990 | Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015 | Engineered | Open in IMG/M |
3300013769 | Sewage treatment plant microbial communities from Vermont, USA - Sand_B | Engineered | Open in IMG/M |
3300014260 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
3300014295 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1 | Environmental | Open in IMG/M |
3300014298 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
3300014864 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10D | Environmental | Open in IMG/M |
3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022204 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1 | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
3300022549 | Cold Creek_combined assembly | Environmental | Open in IMG/M |
3300023073 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5 | Environmental | Open in IMG/M |
3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300025106 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes) | Environmental | Open in IMG/M |
3300025130 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes) | Environmental | Open in IMG/M |
3300025550 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025555 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025948 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025968 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025975 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025980 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026485 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 F6 | Environmental | Open in IMG/M |
3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027796 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 (SPAdes) | Environmental | Open in IMG/M |
3300027802 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate (SPAdes) | Engineered | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Host-Associated | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300034052 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.2 | Engineered | Open in IMG/M |
3300034054 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.1 | Engineered | Open in IMG/M |
3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
3300034196 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
BS_KBA_SWE12_21mDRAFT_101118022 | 3300000124 | Marine | VSGKQVNDGPTDEQRRGIRRTTILLALVALAIYVAFIASGVIKSQH* |
BS_KBA_SWE07_21mDRAFT_10279792 | 3300000134 | Marine | VSGNDVANGPTDQQRRGIRRTTILLVLVALAIYVAFIASGVMKAQH* |
JGIcombinedJ13530_1049136552 | 3300001213 | Wetland | VTGTRMSQFTTEQRRRIRWTTILLAATAIGIYVAFIASSVMKAPH* |
JGI11641J44799_100358231 | 3300002961 | Wetland | DVNDGPTDEQRRGIRRTAILLALVALAIYVAFIASGVMKAQH* |
JGI26145J50221_10225932 | 3300003371 | Arabidopsis Thaliana Rhizosphere | VTGDPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP* |
JGI20214J51088_102717732 | 3300003432 | Wetland | MSDKDVAGGPTDEQRRSIRRTTILLSLVALAIYVAFIASGVIKAQH* |
Ga0031656_100122642 | 3300003858 | Freshwater Lake Sediment | VTAAPMNSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP* |
Ga0031656_100449442 | 3300003858 | Freshwater Lake Sediment | MAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP* |
Ga0031656_100930913 | 3300003858 | Freshwater Lake Sediment | KGMALQEMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP* |
Ga0031653_100367902 | 3300003859 | Freshwater Lake Sediment | MAERDPTXEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP* |
Ga0031654_100099903 | 3300003861 | Freshwater Lake Sediment | MATRMSHGPTEEQRRRIRWTTLVLALTALGIYFAFIASAMMKAPHP* |
Ga0055461_101324452 | 3300003991 | Natural And Restored Wetlands | VSDKQPKDGPTEEQRRGIRRTTILLVLVALAIYVAFIASGVMKAQH* |
Ga0055494_100793731 | 3300004048 | Natural And Restored Wetlands | VSDKQPKDGPTEEQRRGIRRTTILLVLVALAIYVAFIASGVMKAQH |
Ga0055491_101070372 | 3300004050 | Natural And Restored Wetlands | VSDKQPKDGPTEEQRRGIRRTTILLVLVALAIYAAFIASGVMKAQH* |
Ga0066602_104154652 | 3300004151 | Freshwater | MALQEMAEREPTAEQRRRIRRSAIVLALIAIAVYVAFIASGVMKAQP* |
Ga0066603_104918882 | 3300004154 | Freshwater | MTERNPTVTAEQRRRVRRTAIVLAVVAIAIYVAFIASGVMSARG* |
Ga0066600_102787182 | 3300004155 | Freshwater | MNSQQTDEQRRRIRRTTIVLALVALAIYVAFIASGVMKAQH* |
Ga0066600_106792921 | 3300004155 | Freshwater | MNAGPTDEQRRRIRRTTVLLALVALGIYVAFIASSMMKAQP* |
Ga0066600_107405111 | 3300004155 | Freshwater | SQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP* |
Ga0062589_1000446542 | 3300004156 | Soil | VTGELPDDGRRRRIRRNTVVLALIAIAIYVAFIASGVIKSQP* |
Ga0062589_1007242341 | 3300004156 | Soil | GDRTDEQRRRIRRNTLLLTLVALAIYVAFIASSVLHAQA* |
Ga0063356_1058298832 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTQGNQADEQRRRVRRNAILLGLVALGIYVAFIASSVLSAAP* |
Ga0069718_100856242 | 3300004481 | Sediment | MALQDMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP* |
Ga0062591_1025631262 | 3300004643 | Soil | MTERGPTEEQRRRIRRTAIVLAVVAIGIYVIFIASGVMKAQP* |
Ga0062383_101113712 | 3300004778 | Wetland Sediment | MTELDPDAEQRRRIRRTAIVLAAVAIAIYVAFIASGVMKAQP* |
Ga0062383_102951061 | 3300004778 | Wetland Sediment | MSNGPTEEQRRRIRWTTILLALTAIGIYVAFIASAMTKAQH* |
Ga0062380_102756352 | 3300004779 | Wetland Sediment | MTELDPAAEQRRRIRRTAIVLAAVAIAIYVAFIASGVMKAQP* |
Ga0062379_100328972 | 3300004781 | Wetland Sediment | MNSQQTDEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP* |
Ga0062381_101243312 | 3300004808 | Wetland Sediment | VSDKNVTGGPTDEQRRSIRRTTILLSLVALAIYVAFIASGVMKAQH* |
Ga0070676_100878574 | 3300005328 | Miscanthus Rhizosphere | VTGAPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP* |
Ga0070670_1020738282 | 3300005331 | Switchgrass Rhizosphere | VTGELPDDGRRRRIRRNTVVLALIALAIYVAFIASGVIKSQP* |
Ga0070675_1007733211 | 3300005354 | Miscanthus Rhizosphere | MAERDPTEEQRRRIRRTAIVLAVVAIGIYVIFIASGVMKAQP* |
Ga0073905_104258202 | 3300005655 | Activated Sludge | MAERDPTAEQRRRIRRSAIVLALVAIAVYVAFIASGLMKAQP* |
Ga0074478_13291183 | 3300005827 | Sediment (Intertidal) | MAQHEPSAEQRRRVRRSAIVLAVVAIAIYVAFIASGVLGARG* |
Ga0074479_101899933 | 3300005829 | Sediment (Intertidal) | VSSSEVTSNGPTEEQRRAIRRSTIVLVLVALAIYVAFIASGVIKAQP* |
Ga0074472_100783061 | 3300005833 | Sediment (Intertidal) | VSGHDVKDGPTEEQRRGIRRTTILLALVAIAIYVAFIASGVIKAQH* |
Ga0074472_108925682 | 3300005833 | Sediment (Intertidal) | VTNGPTDEQKRGIRRTAVLLALVALAIYVAFIASGVMKAQH* |
Ga0074470_106656081 | 3300005836 | Sediment (Intertidal) | PHLRRSTRRQVSGIKVSDGPTEEQRRGIRRTTIVLALVALAIYVAFIASSVIRAQH* |
Ga0073913_100591322 | 3300005940 | Sand | MNSQQTDAQRRRIRRTAIVLALVALGIYVTFIATGVMKAQP* |
Ga0073914_100335373 | 3300006040 | Sand | MNGQQTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP* |
Ga0082021_10044262 | 3300006092 | Wastewater Treatment Plant | MTQDTRDEERRRRDIRRTTVLLVLVALGIYVAFIASGVMQARP* |
Ga0082021_11140382 | 3300006092 | Wastewater Treatment Plant | MTNGPTDEQRRRIRWTTFVLALTALGIYVAFIASSVLKAQH* |
Ga0082021_117279678 | 3300006092 | Wastewater Treatment Plant | VNDRPANTGPSEQQRRRIRRTTVLLVLVAVGIYVAFIASGIMKAQP* |
Ga0079037_1000407362 | 3300006224 | Freshwater Wetlands | VTNGPTDEQKRGIRRTAILLALVALAIYVAFIASGVMKAQH* |
Ga0079037_1000420172 | 3300006224 | Freshwater Wetlands | MNSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP* |
Ga0079037_1001986663 | 3300006224 | Freshwater Wetlands | MAERDPTAEQRRRIRRSAIVLAVVALAIYVAFIASGVMKAQP* |
Ga0079037_1003921772 | 3300006224 | Freshwater Wetlands | MQNGISEEQRRRIRRTTVVLALVALAIYVAFIASGVMKAQP* |
Ga0079037_1004372912 | 3300006224 | Freshwater Wetlands | MAERDPTEEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP* |
Ga0079037_1007445032 | 3300006224 | Freshwater Wetlands | MDSQQTEQQRRRIRRTTIVLALVALGIYVAFIASGMMKAMP* |
Ga0079037_1011663052 | 3300006224 | Freshwater Wetlands | MAERDPTAAQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP* |
Ga0079037_1012544691 | 3300006224 | Freshwater Wetlands | MNAGPTDEQRRRIRRTTILLALVALGIYVAFIASGVMKAQP* |
Ga0079037_1012577662 | 3300006224 | Freshwater Wetlands | MSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP* |
Ga0079037_1013199982 | 3300006224 | Freshwater Wetlands | MNAGQTDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP* |
Ga0079037_1018487192 | 3300006224 | Freshwater Wetlands | MNAGRSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP* |
Ga0074062_115816302 | 3300006606 | Soil | MSNGPTEEQRRRIRWTTLLLALTALGIYVAFIASAMLKAQH* |
Ga0075428_1000623162 | 3300006844 | Populus Rhizosphere | VTGEPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP* |
Ga0075428_1004473362 | 3300006844 | Populus Rhizosphere | VTGDLSEEERRRRIRRSSVILALVALAIYVAFIASGVLKS* |
Ga0075421_1003936973 | 3300006845 | Populus Rhizosphere | VTGEPDDDRRRRIRRNSVVLALTALAIYVAFIASGVIKSQP* |
Ga0079303_100273492 | 3300006930 | Deep Subsurface | MSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQH* |
Ga0079303_104880342 | 3300006930 | Deep Subsurface | GPTDEQRRRIRRTALVLALVALGIYATFIASGVMRAQG* |
Ga0105105_102562482 | 3300009009 | Freshwater Sediment | MNQDTQADAQRRRIRRTAVVLALVALAIYVAFIASGVMKAQA* |
Ga0105105_104727231 | 3300009009 | Freshwater Sediment | MTERNPTVTAEQRRRVRRTAIVLAVVAIAIYVAFIASGVMSARA* |
Ga0105105_105327592 | 3300009009 | Freshwater Sediment | MAERDPIAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP* |
Ga0114973_1000001959 | 3300009068 | Freshwater Lake | VSDEPTPEQRRRIRRTTFLLVLTALGIYVAFIASGVMKANGHG* |
Ga0105090_1000052516 | 3300009075 | Freshwater Sediment | MTAGGPSDEQRRRIRRTTIVLVIVALGIYVAFIASGVMKAQP* |
Ga0105090_100222802 | 3300009075 | Freshwater Sediment | MAERDPTNEQRRRIRRTAIVLAVVAIGIYVAFIASGVMKAQP* |
Ga0105090_100964722 | 3300009075 | Freshwater Sediment | MTEQDPSLAQRRRIRRTALLLAAVALAIYVAFIASGVMKAQG* |
Ga0105106_106664581 | 3300009078 | Freshwater Sediment | AEREPTAEQRRRIRRSAIVLALVAIAVYVAFIASGVMKAQP* |
Ga0102851_110677542 | 3300009091 | Freshwater Wetlands | MALQDMAERDPTAEQRRRIRRSAIVLAVVALAIYVAFIASGVMKAQP* |
Ga0102851_129910981 | 3300009091 | Freshwater Wetlands | MNAGRSDEQRRRIRRTTILLVLVALGIYVAFIASGIL |
Ga0102851_134113962 | 3300009091 | Freshwater Wetlands | VSTGPTDEQRRRIRRTTFVLALVALGIYVAFIASGVMQARG* |
Ga0115026_114054902 | 3300009111 | Wetland | MNAGQTDEQRRRIRRTTILLALVALGIYVAFIASGVMKAQP* |
Ga0117941_10819703 | 3300009120 | Lake Sediment | MAQDSQTAEQRRRIRRTAILLGVVALAIYVAFIASGVMKAQP* |
Ga0115027_110600212 | 3300009131 | Wetland | MALQEMAEREPTAEQRRRIRRSAIVLALVAIAVYVAFIASGVMKAQS* |
Ga0114129_130470802 | 3300009147 | Populus Rhizosphere | VTGTPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP* |
Ga0111538_104166592 | 3300009156 | Populus Rhizosphere | VTGAPDDERRRRIRRNSVVLALTALAIYVAFIASGV |
Ga0111538_132618062 | 3300009156 | Populus Rhizosphere | TGAPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP* |
Ga0105102_101434553 | 3300009165 | Freshwater Sediment | MTEHDPTDAQRRRIRRTALLLAAVALAIYVAFIASGVMKAQG* |
Ga0113563_100416152 | 3300009167 | Freshwater Wetlands | MNAGPSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP* |
Ga0113563_100901014 | 3300009167 | Freshwater Wetlands | VTAAPMNSQQTDAQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP* |
Ga0113563_110239902 | 3300009167 | Freshwater Wetlands | MDSQQTEQQRRRIRRTTIVLALVALGIYVAFIASGMMKATP* |
Ga0113563_131967802 | 3300009167 | Freshwater Wetlands | MNAGPTDEQRRRIRRTTILLALVAIGIYVAFIASGVMKAQP* |
Ga0105097_102486102 | 3300009169 | Freshwater Sediment | MAERDPTAAQCGRIRRSAIVLAVVAIAIYAAFIASGVMKAQP* |
Ga0114939_1000042632 | 3300009455 | Groundwater | MTEPTAEQRRRVRRSAIMLAVVAIAIYVAFIASGVFGARG* |
Ga0114939_100078998 | 3300009455 | Groundwater | MQNGTSEEQRRRIRRTTVVLALVAVAIYVAFIASGVMKAQP* |
Ga0114939_100404853 | 3300009455 | Groundwater | VSEGRASTGTTAEQRRRIRRTTILLVLIALGIYVAFIASGVMKAQP* |
Ga0118657_100049615 | 3300009506 | Mangrove Sediment | VSNVDSRPGDEQQRRRIRRTAILLALTALGIYVAFIASGIMKATP* |
Ga0118657_100640307 | 3300009506 | Mangrove Sediment | VSDRPLNAGPSEEQRRRIRRMTIVLVLVALAIYVAFIASGVMQARS* |
Ga0118657_113665402 | 3300009506 | Mangrove Sediment | LNAGPTGEQRRRIRRTTIVLALVAIAIYVTFIASGVLGRYG* |
Ga0123573_101775952 | 3300009509 | Mangrove Sediment | MRTGPDEQQRRRIRRSTIVLALVALGIYVAFIASGVMQARG* |
Ga0123573_103392582 | 3300009509 | Mangrove Sediment | VSGVDSRPGDEQQRRRIRRTAILLALTALGIYVAFIASGIMKATP* |
Ga0114942_11609112 | 3300009527 | Groundwater | VPALNDMAEHDPTNEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP* |
Ga0073899_111279262 | 3300009540 | Activated Sludge | AEQRRRIRRSAIVLAVVAIAIYAAFIASGVMKAQP* |
Ga0105347_12634562 | 3300009609 | Soil | VTGELPDDERRRRIRRNTVVLALIALAIYVAFIASGVIKSQP* |
Ga0105340_12133912 | 3300009610 | Soil | VTGERPTEQRRRIRRNTLLLALTAVAIYVAFIVSGVIKAQP* |
Ga0116141_104526882 | 3300009693 | Anaerobic Digestor Sludge | MTNGPTEEQRRRIRWTTFVLALTALGIYVAFIASSVLKAQP* |
Ga0130016_102190002 | 3300009868 | Wastewater | MNAGPTDEQRRRIRRTTIVLVLVALGIYVAFIASGMMGARS* |
Ga0130016_105660502 | 3300009868 | Wastewater | MNAGPTDEQRRRIRRTTIVLVLVALGIYVAFIASSIMGARS* |
Ga0131092_101010962 | 3300009870 | Activated Sludge | VDNGPNEQQRRGIRRTTILLALVALAIYVAFIASGVIKSQH* |
Ga0131092_107132612 | 3300009870 | Activated Sludge | MSNGPTDQQRRRIRWTTILLVATALGIYVAFIASSVMKAQH* |
Ga0131092_108984321 | 3300009870 | Activated Sludge | MDTRMSNGPTDEQRRRIRWTTFLLVVTALGIYVAFIVSSVM |
Ga0134122_102745992 | 3300010400 | Terrestrial Soil | VTGELPDDGRRRRIRRSSVVLALIALAIYVAFIASGVIKSQT* |
Ga0136852_100061542 | 3300010412 | Mangrove Sediment | MDRGPSDDERRRIRRMAILLALTALGIYVAFIASGIMKAQP* |
Ga0139324_10041832 | 3300010997 | Sediment | MDRGPGDDERRRIRRTAILLALTALGIYVAFIASGIMKAQP* |
Ga0159060_11430962 | 3300012990 | Hydrocarbon Resource Environments | MAQDKDEQRRRIRRTAILLVVVALGIYVAFIASSVMSVQP* |
Ga0119887_10016607 | 3300013769 | Sewage Treatment Plant | VSGIKVSDGPTEEQRRGIRRTTIVLALVALAIYVAFIASSVIKAQH* |
Ga0119887_100221010 | 3300013769 | Sewage Treatment Plant | VSAPQGHGPTEQQRRAIRRNTILLSLVAFAIYVAFIASGVIKAQP* |
Ga0075307_10023272 | 3300014260 | Natural And Restored Wetlands | VRANKVSDGPTEEQRRGIRRTTILLALVALAIYVAFIASGVIKAQH* |
Ga0075305_11414522 | 3300014295 | Natural And Restored Wetlands | VSAHKVSDGPTEEQRRGIRRTTILLALVALAIYVAFIASGVIKAQH* |
Ga0075341_10091772 | 3300014298 | Natural And Restored Wetlands | VSDKQRNDGPTEEQRRGIRRTTILLVLVALAIYVAFIASGVMKAQH* |
Ga0075350_10616232 | 3300014315 | Natural And Restored Wetlands | VSDRQVNDGPTEEQRRGIRRTTIVLVLVALAIYVAFIASGVLKSQH* |
Ga0075339_10080812 | 3300014316 | Natural And Restored Wetlands | MNSQQTEEQRRRIRRTTIVLALVALAIYVAFIASGVMKAQP* |
Ga0075348_12207201 | 3300014319 | Natural And Restored Wetlands | VSDRQVNDGPTEEQRRGIRRTTIVLVLVALAIYVAFIASGVLKSQH |
Ga0075355_11727092 | 3300014322 | Natural And Restored Wetlands | MNGPNDEQRRGIRRTTILLVLVTLAIYFAFIASGVIKAQH* |
Ga0180068_10527432 | 3300014864 | Soil | VTGELPDDERRRRIRRNTVVLALIVLAIYVAFIASGVIKSQP* |
Ga0180063_10259431 | 3300014885 | Soil | QHDDQRRRIRRNTILLVLVALGIYVAFIASSVIGAQH* |
Ga0163161_121026812 | 3300017792 | Switchgrass Rhizosphere | VTGDPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP |
Ga0190266_101177732 | 3300017965 | Soil | VTGELPDDERRRRIRRNTVVLALIALAIYVAFIASGVIKSQP |
Ga0187787_103452082 | 3300018029 | Tropical Peatland | SHLTPEQRRGIRRTTILLALVALAIYVAFIASGVIKSQH |
Ga0184628_103209562 | 3300018083 | Groundwater Sediment | MSNGPTVEQRRRIRWTTLLLALTALGIYVAFIASAMLKAQR |
Ga0184628_106562681 | 3300018083 | Groundwater Sediment | SDAQRRRNIRRNALVLALVALGIYVWFIASSVLSARP |
Ga0190265_109235132 | 3300018422 | Soil | VTGEPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP |
Ga0190272_102228922 | 3300018429 | Soil | VTSERPTVQRRRIRRNALLLALTALAIYVAFIVSGVIKAQP |
Ga0190270_113565082 | 3300018469 | Soil | VTGELPDDERRRRIRRNTVVLALIVLAIYVAFIASGVIKSQP |
Ga0190274_103338493 | 3300018476 | Soil | MAERDPTEEQRRRIRRTAIVLALVAIGIYVIFIASGVMKAQP |
Ga0190271_113387422 | 3300018481 | Soil | MSGELSADERRRRIRRNTLVLALTALAIYVAFIVSGVIKAQS |
Ga0210334_102524262 | 3300021859 | Estuarine | MAQHEPSAEQRRRVRRSAIVLAVVAIAIYVAFIASGVLGARG |
Ga0224496_100803112 | 3300022204 | Sediment | MAMAQHEPTAEQRRRVRRSAIVLAVVAIAIYVAFIASGVLGARG |
Ga0224500_1000091618 | 3300022213 | Sediment | MTELDLAAEQRRRIRRTAIVLAVVAIAIYVAFIASGVMNAQP |
Ga0224500_100973371 | 3300022213 | Sediment | EFDPAAEQRRRIRRTAIVLAVVAIAIYVAFIASGVMNAQP |
Ga0224500_101039572 | 3300022213 | Sediment | MAEPTAEQRRRVRRSAIVLAVVALAIYVAFIASGVLGARG |
Ga0224505_1000030418 | 3300022214 | Sediment | MTEFDPAAEQRRRIRRTAIVLAVVAIAIYVAFIASGVMNAQP |
Ga0224505_100281781 | 3300022214 | Sediment | SSKDAALQQMAERDPTAEQRRRIRRSAIVLAVVAIAIYAAFIASGVMKAQP |
Ga0224506_102184773 | 3300022221 | Sediment | GPTDEQRRRIRRTTLVLALVALGIYVAFIASGVMQARQ |
Ga0212091_101673592 | 3300022549 | Groundwater | MAKRESSAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP |
Ga0247744_10128133 | 3300023073 | Soil | VTGAPDDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP |
Ga0124853_10109512 | 3300024056 | Freshwater Wetlands | MTNGPTEQQRRRIRWTTVLLVLTALGIYVAFIASSVLKAQH |
Ga0124853_14397503 | 3300024056 | Freshwater Wetlands | MNSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP |
Ga0124853_14556442 | 3300024056 | Freshwater Wetlands | MAERDPTAEQRRRIRRSAIVLAVVALAIYVAFIASGVMKAQP |
Ga0209398_10028123 | 3300025106 | Groundwater | VSEGRASTGTTAEQRRRIRRTTILLVLVALGIYVAFIASGVMKAQP |
Ga0209594_100137112 | 3300025130 | Groundwater | MQNGTSEEQRRRIRRTTVVLALVAVAIYVAFIASGVMKAQP |
Ga0209594_10043852 | 3300025130 | Groundwater | MTEPTAEQRRRVRRSAIMLAVVAIAIYVAFIASGVFGARG |
Ga0210098_10415252 | 3300025550 | Natural And Restored Wetlands | VSANKVSDGPTEEQRRGIRRTTILLALVALAIYVAFIASGVIKAQH |
Ga0210121_10032963 | 3300025555 | Natural And Restored Wetlands | VNDGPTAEQRRGIRRTTIVLALVALAIYVAFIASGVIKSQH |
Ga0207643_104794982 | 3300025908 | Miscanthus Rhizosphere | VTGELPDDGRRRRIRRNTVVLALIALAIYVAFIASGVIKSQP |
Ga0207650_113373152 | 3300025925 | Switchgrass Rhizosphere | VTGELPDDGRRRRIRRNTVVLALIALAIYVAFIASGVIKSRP |
Ga0210088_10196522 | 3300025948 | Natural And Restored Wetlands | MDSQQTEEQRRRIRRTTIVLALVALAIYVAFIASGVMKAQP |
Ga0210103_10095322 | 3300025968 | Natural And Restored Wetlands | VSDKQPKDGPTEEQRRGIRRTTILLVLVALAIYAAFIASGVMKAQH |
Ga0210091_10135742 | 3300025975 | Natural And Restored Wetlands | MSDKDVAGGPTDEQRRSIRRTTILLSLVALAIYVAFIASGVIKAQH |
Ga0210137_10459161 | 3300025980 | Natural And Restored Wetlands | MSDKDVAGGPTDEQRRSIRRTTILLSLVALAIYVAFIASG |
Ga0256805_10155232 | 3300026485 | Sediment | VRGGAGTVEEGPNQEQRRGIRRTTLLLALVALAIYVAFIASGVIKSQH |
Ga0209392_10047812 | 3300027683 | Freshwater Sediment | MTERNPTVTAEQRRRVRRTAIVLAVVAIAIYVAFIASGVMSVRG |
Ga0209392_10657402 | 3300027683 | Freshwater Sediment | MAERDPTNEQRRRIRRTAIVLAVVAIGIYVAFIASGVMKAQP |
Ga0209392_10882442 | 3300027683 | Freshwater Sediment | MTAGGPSDEQRRRIRRTTIVLVIVALGIYVAFIASGVMKAQP |
Ga0209704_11175332 | 3300027693 | Freshwater Sediment | MTERNPTVTAEQRRRVRRTAIVLAVVAIAIYVAFIASGVMSARG |
Ga0208665_100069923 | 3300027715 | Deep Subsurface | MSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP |
Ga0209682_100063013 | 3300027716 | Wetland Sediment | MNSQQTDEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP |
Ga0209492_13082822 | 3300027721 | Freshwater Sediment | MAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP |
Ga0209464_100836623 | 3300027778 | Wetland Sediment | VSDKNVTGGPTDEQRRSIRRTTILLALVALAIYVAFIASGVMKAQH |
Ga0209464_102535622 | 3300027778 | Wetland Sediment | MSNGPTEEQRRRIRWTTILLALTAIGIYVAFIASAMTKAQH |
Ga0209464_103806582 | 3300027778 | Wetland Sediment | DEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP |
Ga0209373_103144682 | 3300027796 | Freshwater | MAQGSQTAEQRRRIRRTAILLGVVALAIYVAFIASGVMKAQP |
Ga0209476_103310471 | 3300027802 | Activated Sludge | MAERDPTAEQRRRIRRSAIVLALVAIAVYVAFIASGL |
Ga0209797_100374453 | 3300027831 | Wetland Sediment | MTELDPAAEQRRRIRRTAIVLAAVAIAIYVAFIASGVMKAQP |
Ga0209262_100214881 | 3300027841 | Freshwater | PTDEQRRRIRRTALVLALVALGIYVAFIASGVMRAQG |
Ga0209262_101101062 | 3300027841 | Freshwater | MALQEMAEREPTAEQRRRIRRSAIVLALIAIAVYVAFIASGVMKAQP |
Ga0209262_101792172 | 3300027841 | Freshwater | MNSQQTDEQRRRIRRTTIVLALVALAIYVAFIASGVMKAQH |
Ga0209262_102086642 | 3300027841 | Freshwater | MSSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP |
Ga0209262_104586041 | 3300027841 | Freshwater | DPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP |
Ga0209397_106373861 | 3300027871 | Wetland | TGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP |
Ga0209293_103648972 | 3300027877 | Wetland | MNAGRSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP |
Ga0209450_100200317 | 3300027885 | Freshwater Lake Sediment | MTGGPTSEQRRRIRWTTVLLVLTALGIYVAFIASSVLKAQH |
Ga0209450_100407175 | 3300027885 | Freshwater Lake Sediment | MAQDSQTAEQRRRIRRTAILLGVVALAIYVAFIASGVMKAQP |
Ga0209450_101139711 | 3300027885 | Freshwater Lake Sediment | ALNEMAERDPTEEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP |
Ga0209450_102857123 | 3300027885 | Freshwater Lake Sediment | ERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP |
Ga0209450_104713162 | 3300027885 | Freshwater Lake Sediment | MSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQH |
Ga0208980_100055952 | 3300027887 | Wetland | VNDGPTDEQRRGIRRTAILLALVALAIYVAFIASGVMKAQH |
Ga0209496_101449691 | 3300027890 | Wetland | GPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQH |
Ga0209496_103333982 | 3300027890 | Wetland | MALQDMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQS |
Ga0209254_102306312 | 3300027897 | Freshwater Lake Sediment | MNGQQTEEQRRRIRRTTIVLALVALGIYMAFIASGVMKAQP |
Ga0209668_100877572 | 3300027899 | Freshwater Lake Sediment | MNPGPTSEQRRRIRWTTVVLALIAIGIYVAFIASSVIKARH |
Ga0209668_101319512 | 3300027899 | Freshwater Lake Sediment | MAERDPTEEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP |
Ga0209668_101341743 | 3300027899 | Freshwater Lake Sediment | VSGSEVTSNGPTEEQRRAIRRSTIVLVLVALVIYVAFIASGVMKAQP |
Ga0209668_101595492 | 3300027899 | Freshwater Lake Sediment | MTGARMTNGPTEQQRRRIRWTTVLLVLTALGIYVAFIASSVLKAQH |
Ga0209668_102197302 | 3300027899 | Freshwater Lake Sediment | MAERDQTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP |
Ga0209668_102226233 | 3300027899 | Freshwater Lake Sediment | VNDGPTDKQRRAIRRTAILLALVALAIYVAFIASGVMKAQH |
Ga0209668_103536462 | 3300027899 | Freshwater Lake Sediment | MGSQQTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP |
Ga0209668_104195232 | 3300027899 | Freshwater Lake Sediment | MAERDPTAEQRRRIRRTAIVLAVVAIAIYVAFIASGVMKAQP |
Ga0209253_1000774713 | 3300027900 | Freshwater Lake Sediment | MATRMSNGPTEQQRRRIRWTTIVLALTAIGIYVAFIASAMMKSQH |
Ga0209253_103763193 | 3300027900 | Freshwater Lake Sediment | MSQGRTVEQRRRIRWTTVLLVLTALGIYVAFIASSVLKAPH |
Ga0209253_106232412 | 3300027900 | Freshwater Lake Sediment | MAQGTQTAEQRRRIRRTAILLGVVALAIYVAFIASGVMKAQP |
Ga0209253_108765541 | 3300027900 | Freshwater Lake Sediment | QTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP |
Ga0209048_100100365 | 3300027902 | Freshwater Lake Sediment | MRSGPTDEQRRRIRWTTVLLALAALGIYVAFIASSVMKARH |
Ga0209048_100730573 | 3300027902 | Freshwater Lake Sediment | MSHGPTEEQRRRIRWTTLVLALTALGIYFAFIASAMMKAPHP |
Ga0209382_100921272 | 3300027909 | Populus Rhizosphere | VTGDLSEEERRRRIRRSSVILALVALAIYVAFIASGVLKS |
Ga0209536_1010175762 | 3300027917 | Marine Sediment | MSSGPTDEQRRRIRRNSIVLALTALAIYVTFIVSGMLRVPN |
Ga0209079_100058566 | 3300027972 | Freshwater Sediment | MTEQDPSLAQRRRIRRTALLLAAVALAIYVAFIASGVMKAQG |
Ga0209079_101947382 | 3300027972 | Freshwater Sediment | MTEHDPTDAQRRRIRRTAFLLAAVALAIYVAFIASGVMKAQG |
Ga0272412_10824571 | 3300028647 | Activated Sludge | MTQDTRDEERRRRDIRRTTVLLVLVALGIYVAFIASGVMQARP |
Ga0299906_100339763 | 3300030606 | Soil | VIGGRPTEQRRRIRRNTLLLALTALAIYVAFIVSGVIKAQP |
Ga0268386_100000265 | 3300030619 | Soil | VTGELPEDERRRRIRRNTVVLALIAIAIYVAFIASGVIKSQA |
Ga0316575_100539153 | 3300031665 | Rhizosphere | MSRGPGDDERRRIRRTAILLALTALGIYVAFIASGIMKAQP |
Ga0315288_103488763 | 3300031772 | Sediment | MAERGPTAEQRRRIRRSAIVLAVVAITIYVAFIASGVMKAQP |
Ga0315290_100993833 | 3300031834 | Sediment | MAERDPTAEQRRRIRRSAIVLAVVAIGIYVAFIASGVMKAQP |
Ga0315290_102232422 | 3300031834 | Sediment | VSGNDVSNGPTDEQKRGIRRTTILLALVALAIYVAFIASGVMKARH |
Ga0315290_102458912 | 3300031834 | Sediment | MAQDSQTAEQRRRIRRAAILLGVVALAIYVAFIASGVMKAQP |
Ga0315290_103413133 | 3300031834 | Sediment | MSNGPTEQQRRRIRWTTILLALTAIGIYVAFIASAMMKSQH |
Ga0315290_103418871 | 3300031834 | Sediment | MNLGPTSEQRRRIRWTTVVLALIAIGIYVAFIASSVIKARP |
Ga0315909_109423722 | 3300031857 | Freshwater | VTAAPMNSQQTDAQRRRIRRTTIVLALVALGIYVTFIASGVMKAQP |
Ga0315297_100086872 | 3300031873 | Sediment | MSQGPTAEQRRRIRRTTVLLALTALGIYVAFIASSVLKAPH |
Ga0315297_104330452 | 3300031873 | Sediment | VSGNDVTNGPTDQQKRGIRRTTILLALVALAIYVAFIASGVMKAQH |
Ga0315297_106134312 | 3300031873 | Sediment | MNTGLTDEQRRRIRRTAILLALVALGIYAAFIASGVIKAQH |
Ga0310901_100019795 | 3300031940 | Soil | VTGDPNDERRRRIRRNSVVLALTALAIYVAFIASGVIKSQP |
Ga0315278_106143242 | 3300031997 | Sediment | MAERGPTAEQRRRIRRSAIVLAVVAITIYVAFIASGVMSAQP |
Ga0315905_111788982 | 3300032092 | Freshwater | MAQHEPTAEQRRRVRRSAIVLAVVAIAIYAAFIASGVLGARG |
Ga0315292_107630872 | 3300032143 | Sediment | VTAAPMNRQQTDEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP |
Ga0315295_116150752 | 3300032156 | Sediment | MSNGPTEQQRRRIRWTTIVLALTAIGIYVAFIASAMMKSQH |
Ga0315283_118786922 | 3300032164 | Sediment | MNSQQTDAQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP |
Ga0315276_111208463 | 3300032177 | Sediment | NDVTNGPTDQQKRGIRRTTILLALVALAIYVAFIASGVMKAQH |
Ga0307471_1038767792 | 3300032180 | Hardwood Forest Soil | VSDDASSERRRRIRRNSVVLALVAAAIYVGFIVSGVIRAQH |
Ga0315271_106477282 | 3300032256 | Sediment | MNPGPTSEQRRRIRWSAIVLALIAIGIYVAFIASSVIKARH |
Ga0315271_109010722 | 3300032256 | Sediment | MSNGPTDEQRRRIRWTTLVLALVALGIYVAFIASAMMKAQP |
Ga0315271_115262022 | 3300032256 | Sediment | QVTAAPMNSQQTDEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP |
Ga0315286_117202652 | 3300032342 | Sediment | VTAAPMNSQQTDEQRRRIRRTTIVLALVALGIYAAFIASGVMKAQP |
Ga0315287_1000367111 | 3300032397 | Sediment | MNSQQTEERRRRIRRTTIVLALVALGIYAAFIASGVMKAQP |
Ga0315287_105011792 | 3300032397 | Sediment | MNPGPTSEQRRRIRWTAVVLALIAIGIYVAFIASSVIKARH |
Ga0315287_110799682 | 3300032397 | Sediment | MNGQQTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP |
Ga0315287_110878662 | 3300032397 | Sediment | MSSQQTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQP |
Ga0315287_124631472 | 3300032397 | Sediment | VSVSEVTRNGPTEEQRRAIRRSTIVLVLVALAIYVAFIASGVMKAQP |
Ga0335084_115176552 | 3300033004 | Soil | VRGGAGTVDQGPNQEQRRGIRRTTLLLALVALAIYVAFIASGVIKSQH |
Ga0316604_105127132 | 3300033406 | Soil | MDSQQTEQQRRRIRRTTIVLALVALGIYVAFIASGMMKAMP |
Ga0316604_107989132 | 3300033406 | Soil | MNAGQTDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP |
Ga0316604_108373851 | 3300033406 | Soil | SKGMALQDMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP |
Ga0316605_106669202 | 3300033408 | Soil | VSGEHVNQGPTDRQRRRIRRTTILLALVALGIYVAFIASGVMKAQP |
Ga0316605_114260132 | 3300033408 | Soil | MQNGISEEQRRRIRRTTVVLALVALAIYVAFIASGVMKAQP |
Ga0316605_114346691 | 3300033408 | Soil | NGISEEQRRRIRRTTVVLALVALAIYVAFIASGVMKAQP |
Ga0316605_114969312 | 3300033408 | Soil | MALQDMAERDPTAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKAQP |
Ga0316605_121518182 | 3300033408 | Soil | MNQGGPLDEQRRRNVRWTAIVLALIALGIYVAFIASSVMKAQH |
Ga0316605_123491651 | 3300033408 | Soil | MALQEMAEREPTAEQRRRIRRSAIVLALVAIAVYVAFIASGVMKAQS |
Ga0316605_124337852 | 3300033408 | Soil | VPASNDMAEHEPTSEQRRRIRRTAIVLAVVAIAIYVAFIASGVMKAQP |
Ga0316603_104216793 | 3300033413 | Soil | MALQEMAEREPTAEQRRRIRRSAIVLALVVIAVYVAFIASGVMKAQS |
Ga0316603_105829563 | 3300033413 | Soil | PGPTDRQRRRIRRTTILLALVALGIYVAFIASGVMKAQP |
Ga0316603_107188492 | 3300033413 | Soil | MNAGPSDEQRRRIRRTTVVLVLVALGIYVAFIASSMMKAQP |
Ga0316603_122559871 | 3300033413 | Soil | EHEPTSEQRRRIRRTAIVLAVVAIAIYVAFIASGVMKAQP |
Ga0316619_105847642 | 3300033414 | Soil | MNAGPTDEQRRRIRRTTILLALVALGIYVAFIASGVMKAQP |
Ga0316619_106121822 | 3300033414 | Soil | VSGKQVNDGPTDEQRRGIRRTTIVLALVALAIYVAFIASGVIKSQH |
Ga0316625_1003964612 | 3300033418 | Soil | VSAKPVNEGQSEQQRRAIRRTTILLVLVALGIYVAFIASGVIKAQH |
Ga0316625_1014264212 | 3300033418 | Soil | VSAPEGHGPTEQQRRAIRRNTILLSLVALAIYVAFIASGVIKAQP |
Ga0316625_1024365201 | 3300033418 | Soil | MDSQQTEQQRRRIRRTTIALALVALGIYVAFIASGMMKAMS |
Ga0316601_1005995742 | 3300033419 | Soil | MNAGPSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP |
Ga0316601_1011564882 | 3300033419 | Soil | MALQEMAEREPTAEQRRRIRRSAIVLALIAIAVYVAFIASGVMKAQS |
Ga0316613_101089751 | 3300033434 | Soil | PTAEQRRRIRRSAIVLALVAIAVYVAFIASGVMKAQS |
Ga0316627_1001276421 | 3300033482 | Soil | GRQVRNRAMNAGPSDEQRRRIRRTTILLVLVALGIYVAFIASGILKAQP |
Ga0316627_1005285692 | 3300033482 | Soil | VSGGHVNTGPTDEQRRRIRRTTIVLALVALGIYVAFIVSGVMKAQP |
Ga0316629_113163731 | 3300033483 | Soil | NPGPTDRQRRRIRRTTILLALVALGIYVAFIASGVMKAQP |
Ga0316626_102326732 | 3300033485 | Soil | MDSQQTEQQRRRIRRTTIVLALVALGIYVAFIASGMMKATP |
Ga0316626_103703631 | 3300033485 | Soil | PALQDMAERDPTAEQRRRIRRSAIVLAVVALAIYVAFIASGVMKAQP |
Ga0316630_100212771 | 3300033487 | Soil | MSTGPTEEQRRRIRRTTIVLALVALGIYVAFIASGVMKAQ |
Ga0373889_010515_158_280 | 3300034052 | Sediment Slurry | MTEPTAEQRRRVRRSAIVLGVVAIAIYVAFIMSGVLGARG |
Ga0373889_021643_621_749 | 3300034052 | Sediment Slurry | MTEHDPIEAQRRRIRRTALLLAAVALAIYVAFIASGVMKAQG |
Ga0373891_033730_486_614 | 3300034054 | Sediment Slurry | MAEHDTTEEQRRRIRRSALVLAVVAIAIYVAFIASGVMKAQP |
Ga0370490_0022335_401_529 | 3300034128 | Untreated Peat Soil | MAERDPTNEQRRRIRRSAIVLAVVAIAIYAAFIASGVMKAQP |
Ga0364927_0116407_169_297 | 3300034148 | Sediment | VTRELPDDERRRRIRRNTVVLALIALAIYVAFIASGVIKSQP |
Ga0364929_0261250_26_154 | 3300034149 | Sediment | VTGELPDDERRRRIRRNTMVLALIALAIYVAFIASGVIKSQP |
Ga0364929_0267749_474_578 | 3300034149 | Sediment | VTGELPDDERRRRIRRNTMVLALIALAIYVAFIAS |
Ga0364933_168268_391_519 | 3300034150 | Sediment | VTGELPDDERRRRIRRNTVVLALIALAIYVAFIASGVIKSHT |
Ga0364935_0017066_93_221 | 3300034151 | Sediment | VTGELPDVERRRRIRRNTVVLALIALAIYVAFIASGVIKSQP |
Ga0370480_0004625_4048_4176 | 3300034169 | Untreated Peat Soil | MAERDPTSEQRRRIRRSAIVLAVIAVAIYAAFIASGVMKAQP |
Ga0364931_0014685_1359_1484 | 3300034176 | Sediment | VTGERPTEQRRRIRRNTLLLALTALAIYVAFIVSGVIKAQP |
Ga0370499_0203000_48_173 | 3300034194 | Untreated Peat Soil | VTTGPTDEQRRRIRRTTVVLALVALGIYVAFIASGVMQARG |
Ga0370503_0229346_161_289 | 3300034196 | Untreated Peat Soil | MADRDPSAEQRRRIRRSAIVLAVVAIAIYVAFIASGVMKSQP |
⦗Top⦘ |