Basic Information | |
---|---|
Family ID | F015142 |
Family Type | Metagenome |
Number of Sequences | 257 |
Average Sequence Length | 42 residues |
Representative Sequence | RIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFCLFSLS |
Number of Associated Samples | 205 |
Number of Associated Scaffolds | 257 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 23.32 % |
% of genes near scaffold ends (potentially truncated) | 87.16 % |
% of genes from short scaffolds (< 2000 bps) | 59.14 % |
Associated GOLD sequencing projects | 192 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.23 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (60.311 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (10.117 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.074 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.086 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.17% β-sheet: 0.00% Coil/Unstructured: 71.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 257 Family Scaffolds |
---|---|---|
PF08483 | Obsolete Pfam Family | 26.85 |
PF01695 | IstB_IS21 | 26.85 |
PF00665 | rve | 14.79 |
PF11154 | DUF2934 | 1.17 |
PF00589 | Phage_integrase | 0.78 |
PF03235 | DUF262 | 0.78 |
PF12704 | MacB_PCD | 0.78 |
PF13408 | Zn_ribbon_recom | 0.39 |
PF04365 | BrnT_toxin | 0.39 |
PF01555 | N6_N4_Mtase | 0.39 |
PF00196 | GerE | 0.39 |
PF01436 | NHL | 0.39 |
PF05016 | ParE_toxin | 0.39 |
PF01641 | SelR | 0.39 |
PF00578 | AhpC-TSA | 0.39 |
PF00805 | Pentapeptide | 0.39 |
PF01609 | DDE_Tnp_1 | 0.39 |
PF13604 | AAA_30 | 0.39 |
PF13975 | gag-asp_proteas | 0.39 |
PF00872 | Transposase_mut | 0.39 |
PF02195 | ParBc | 0.39 |
PF01850 | PIN | 0.39 |
PF02405 | MlaE | 0.39 |
PF01408 | GFO_IDH_MocA | 0.39 |
PF13668 | Ferritin_2 | 0.39 |
PF13541 | ChlI | 0.39 |
PF01894 | UPF0047 | 0.39 |
PF01904 | DUF72 | 0.39 |
PF02796 | HTH_7 | 0.39 |
PF13229 | Beta_helix | 0.39 |
PF13649 | Methyltransf_25 | 0.39 |
PF07021 | MetW | 0.39 |
PF00753 | Lactamase_B | 0.39 |
PF06739 | SBBP | 0.39 |
PF01548 | DEDD_Tnp_IS110 | 0.39 |
PF08240 | ADH_N | 0.39 |
PF02719 | Polysacc_synt_2 | 0.39 |
PF01527 | HTH_Tnp_1 | 0.39 |
PF05025 | RbsD_FucU | 0.39 |
PF01814 | Hemerythrin | 0.39 |
COG ID | Name | Functional Category | % Frequency in 257 Family Scaffolds |
---|---|---|---|
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 26.85 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 14.79 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 14.79 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 14.79 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 14.79 |
COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 0.78 |
COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.78 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.39 |
COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.39 |
COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.39 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.39 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.39 |
COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.39 |
COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.39 |
COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.39 |
COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.39 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.39 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.39 |
COG1869 | D-ribose pyranose/furanose isomerase RbsD | Carbohydrate transport and metabolism [G] | 0.39 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.39 |
COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.39 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.39 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.39 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.39 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.39 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.39 |
COG4154 | L-fucose mutarotase/ribose pyranase, RbsD/FucU family | Carbohydrate transport and metabolism [G] | 0.39 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.39 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.39 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.39 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.31 % |
Unclassified | root | N/A | 39.69 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10240554 | Not Available | 589 | Open in IMG/M |
3300001356|JGI12269J14319_10039690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2971 | Open in IMG/M |
3300001454|JGI20204J15135_1001012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2840 | Open in IMG/M |
3300002071|JGIcombinedJ21915_10171663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100094860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2788 | Open in IMG/M |
3300002563|JGI24138J36424_10012771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2787 | Open in IMG/M |
3300002568|C688J35102_119422328 | Not Available | 692 | Open in IMG/M |
3300004635|Ga0062388_100415790 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
3300005175|Ga0066673_10896444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300005176|Ga0066679_10592469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
3300005332|Ga0066388_103870435 | Not Available | 764 | Open in IMG/M |
3300005336|Ga0070680_101477025 | Not Available | 589 | Open in IMG/M |
3300005434|Ga0070709_10088926 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
3300005454|Ga0066687_10073441 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
3300005467|Ga0070706_101142345 | Not Available | 716 | Open in IMG/M |
3300005467|Ga0070706_101552459 | All Organisms → cellular organisms → Bacteria → Atribacterota → unclassified Atribacterota → Candidatus Atribacteria bacterium HGW-Atribacteria-1 | 604 | Open in IMG/M |
3300005468|Ga0070707_101496842 | Not Available | 642 | Open in IMG/M |
3300005526|Ga0073909_10029329 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
3300005529|Ga0070741_10059855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4451 | Open in IMG/M |
3300005533|Ga0070734_10269681 | Not Available | 975 | Open in IMG/M |
3300005534|Ga0070735_10138367 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
3300005535|Ga0070684_102322135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300005541|Ga0070733_10773510 | Not Available | 645 | Open in IMG/M |
3300005548|Ga0070665_101971803 | Not Available | 589 | Open in IMG/M |
3300005554|Ga0066661_10195091 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300005575|Ga0066702_10619698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
3300005577|Ga0068857_100318040 | Not Available | 1437 | Open in IMG/M |
3300005610|Ga0070763_10147955 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300005610|Ga0070763_10869769 | Not Available | 535 | Open in IMG/M |
3300005898|Ga0075276_10045718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
3300006028|Ga0070717_10041728 | All Organisms → cellular organisms → Bacteria | 3741 | Open in IMG/M |
3300006172|Ga0075018_10190247 | Not Available | 968 | Open in IMG/M |
3300006176|Ga0070765_101608161 | Not Available | 611 | Open in IMG/M |
3300006638|Ga0075522_10546312 | Not Available | 533 | Open in IMG/M |
3300006642|Ga0075521_10014459 | All Organisms → cellular organisms → Bacteria | 3112 | Open in IMG/M |
3300006642|Ga0075521_10670471 | Not Available | 511 | Open in IMG/M |
3300006800|Ga0066660_11264225 | Not Available | 578 | Open in IMG/M |
3300006872|Ga0101947_1043551 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
3300006893|Ga0073928_10077317 | Not Available | 2862 | Open in IMG/M |
3300006904|Ga0075424_100947627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
3300009088|Ga0099830_10870313 | Not Available | 744 | Open in IMG/M |
3300009089|Ga0099828_11189890 | Not Available | 676 | Open in IMG/M |
3300009137|Ga0066709_103698994 | Not Available | 555 | Open in IMG/M |
3300009157|Ga0105092_10328188 | Not Available | 865 | Open in IMG/M |
3300009163|Ga0114970_10063635 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 2350 | Open in IMG/M |
3300009168|Ga0105104_10628532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300009519|Ga0116108_1224657 | Not Available | 549 | Open in IMG/M |
3300009521|Ga0116222_1373980 | Not Available | 619 | Open in IMG/M |
3300009524|Ga0116225_1027042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 2884 | Open in IMG/M |
3300009524|Ga0116225_1145619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1083 | Open in IMG/M |
3300009616|Ga0116111_1004800 | All Organisms → cellular organisms → Bacteria | 6839 | Open in IMG/M |
3300009640|Ga0116126_1017484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3231 | Open in IMG/M |
3300009645|Ga0116106_1095953 | Not Available | 961 | Open in IMG/M |
3300009676|Ga0116187_1064626 | Not Available | 1936 | Open in IMG/M |
3300009764|Ga0116134_1016452 | All Organisms → cellular organisms → Bacteria | 3069 | Open in IMG/M |
3300009824|Ga0116219_10055029 | All Organisms → cellular organisms → Bacteria | 2355 | Open in IMG/M |
3300010046|Ga0126384_10285334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1351 | Open in IMG/M |
3300010047|Ga0126382_12517975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 502 | Open in IMG/M |
3300010341|Ga0074045_10077976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 2324 | Open in IMG/M |
3300010341|Ga0074045_10452384 | Not Available | 829 | Open in IMG/M |
3300010359|Ga0126376_12181244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300010359|Ga0126376_12251298 | Not Available | 590 | Open in IMG/M |
3300010361|Ga0126378_10323683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1648 | Open in IMG/M |
3300010361|Ga0126378_10622159 | Not Available | 1193 | Open in IMG/M |
3300010379|Ga0136449_100059953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 8359 | Open in IMG/M |
3300010379|Ga0136449_100323262 | All Organisms → cellular organisms → Bacteria | 2794 | Open in IMG/M |
3300010379|Ga0136449_102539537 | Not Available | 733 | Open in IMG/M |
3300010400|Ga0134122_10674092 | Not Available | 967 | Open in IMG/M |
3300011271|Ga0137393_11174034 | Not Available | 652 | Open in IMG/M |
3300012202|Ga0137363_10004500 | All Organisms → cellular organisms → Bacteria | 8552 | Open in IMG/M |
3300012202|Ga0137363_10312837 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
3300012205|Ga0137362_10093030 | All Organisms → cellular organisms → Bacteria | 2529 | Open in IMG/M |
3300012205|Ga0137362_11460762 | Not Available | 570 | Open in IMG/M |
3300012361|Ga0137360_10091668 | All Organisms → cellular organisms → Bacteria | 2304 | Open in IMG/M |
3300012533|Ga0138256_10212300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 1716 | Open in IMG/M |
3300012533|Ga0138256_10782896 | Not Available | 736 | Open in IMG/M |
3300012533|Ga0138256_10884563 | Not Available | 681 | Open in IMG/M |
3300014150|Ga0134081_10354155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300014159|Ga0181530_10473559 | Not Available | 627 | Open in IMG/M |
3300014161|Ga0181529_10047203 | All Organisms → cellular organisms → Bacteria | 3069 | Open in IMG/M |
3300014165|Ga0181523_10786804 | Not Available | 518 | Open in IMG/M |
3300014169|Ga0181531_10918230 | Not Available | 548 | Open in IMG/M |
3300014199|Ga0181535_10688913 | Not Available | 582 | Open in IMG/M |
3300014199|Ga0181535_10867579 | Not Available | 509 | Open in IMG/M |
3300014201|Ga0181537_10861193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
3300014492|Ga0182013_10393634 | Not Available | 745 | Open in IMG/M |
3300014493|Ga0182016_10062818 | Not Available | 2805 | Open in IMG/M |
3300014494|Ga0182017_10049722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2799 | Open in IMG/M |
3300014496|Ga0182011_10015725 | All Organisms → cellular organisms → Bacteria | 5560 | Open in IMG/M |
3300014496|Ga0182011_10032192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3768 | Open in IMG/M |
3300014496|Ga0182011_10630939 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300014496|Ga0182011_10677709 | Not Available | 651 | Open in IMG/M |
3300014498|Ga0182019_10035859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2803 | Open in IMG/M |
3300014499|Ga0182012_10726260 | Not Available | 632 | Open in IMG/M |
3300014502|Ga0182021_10133678 | Not Available | 2883 | Open in IMG/M |
3300014502|Ga0182021_11684352 | Not Available | 764 | Open in IMG/M |
3300014502|Ga0182021_12358969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 640 | Open in IMG/M |
3300014502|Ga0182021_12549825 | Not Available | 615 | Open in IMG/M |
3300014638|Ga0181536_10002724 | All Organisms → cellular organisms → Bacteria | 19657 | Open in IMG/M |
3300014638|Ga0181536_10006752 | All Organisms → cellular organisms → Bacteria | 11427 | Open in IMG/M |
3300014638|Ga0181536_10012188 | All Organisms → cellular organisms → Bacteria | 7769 | Open in IMG/M |
3300014638|Ga0181536_10021295 | All Organisms → cellular organisms → Bacteria | 5228 | Open in IMG/M |
3300014638|Ga0181536_10060036 | All Organisms → cellular organisms → Bacteria | 2410 | Open in IMG/M |
3300014638|Ga0181536_10138922 | Not Available | 1298 | Open in IMG/M |
3300014638|Ga0181536_10144862 | Not Available | 1259 | Open in IMG/M |
3300014658|Ga0181519_10208684 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
3300014838|Ga0182030_10146150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3024 | Open in IMG/M |
3300014838|Ga0182030_10147555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3002 | Open in IMG/M |
3300014838|Ga0182030_10386279 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
3300014839|Ga0182027_10041429 | All Organisms → cellular organisms → Bacteria | 5864 | Open in IMG/M |
3300014839|Ga0182027_10110606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3294 | Open in IMG/M |
3300014969|Ga0157376_13052097 | Not Available | 507 | Open in IMG/M |
3300015053|Ga0137405_1007126 | All Organisms → cellular organisms → Bacteria | 2312 | Open in IMG/M |
3300015197|Ga0167638_1062069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
3300015259|Ga0180085_1148839 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300015264|Ga0137403_10106808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2803 | Open in IMG/M |
3300016294|Ga0182041_12209631 | Not Available | 514 | Open in IMG/M |
3300017823|Ga0187818_10221487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
3300017940|Ga0187853_10025921 | All Organisms → cellular organisms → Bacteria | 3187 | Open in IMG/M |
3300017942|Ga0187808_10561096 | Not Available | 531 | Open in IMG/M |
3300017975|Ga0187782_10058476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2806 | Open in IMG/M |
3300017988|Ga0181520_10729028 | Not Available | 674 | Open in IMG/M |
3300018013|Ga0187873_1224352 | Not Available | 698 | Open in IMG/M |
3300018030|Ga0187869_10151704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
3300018034|Ga0187863_10459443 | Not Available | 711 | Open in IMG/M |
3300018035|Ga0187875_10480746 | Not Available | 660 | Open in IMG/M |
3300018047|Ga0187859_10293111 | Not Available | 880 | Open in IMG/M |
3300018047|Ga0187859_10488978 | Not Available | 684 | Open in IMG/M |
3300018062|Ga0187784_10535714 | Not Available | 942 | Open in IMG/M |
3300018088|Ga0187771_11375607 | Not Available | 599 | Open in IMG/M |
3300018468|Ga0066662_11068135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
3300018468|Ga0066662_12395711 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300019788|Ga0182028_1424067 | Not Available | 1452 | Open in IMG/M |
3300020186|Ga0163153_10045080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3079 | Open in IMG/M |
3300021406|Ga0210386_11613871 | Not Available | 538 | Open in IMG/M |
3300021433|Ga0210391_10769873 | Not Available | 753 | Open in IMG/M |
3300021475|Ga0210392_10241403 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
3300021476|Ga0187846_10104660 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300021560|Ga0126371_11273928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 869 | Open in IMG/M |
3300022593|Ga0236338_1022579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1490 | Open in IMG/M |
3300022835|Ga0224537_1011240 | Not Available | 723 | Open in IMG/M |
3300022875|Ga0224553_1009437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2821 | Open in IMG/M |
3300023068|Ga0224554_1123763 | Not Available | 578 | Open in IMG/M |
3300023258|Ga0224535_1081138 | Not Available | 713 | Open in IMG/M |
3300024238|Ga0224523_1004193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4782 | Open in IMG/M |
3300024238|Ga0224523_1075831 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300025553|Ga0208080_1052463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
3300025633|Ga0208480_1004178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4928 | Open in IMG/M |
3300025725|Ga0209638_1085001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1160 | Open in IMG/M |
3300025764|Ga0209539_1038191 | All Organisms → cellular organisms → Bacteria | 2103 | Open in IMG/M |
3300025865|Ga0209226_10152435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
3300025878|Ga0209584_10011396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2931 | Open in IMG/M |
3300025912|Ga0207707_10073314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2985 | Open in IMG/M |
3300025913|Ga0207695_10016993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8488 | Open in IMG/M |
3300026297|Ga0209237_1033589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2771 | Open in IMG/M |
3300026381|Ga0255357_1002444 | Not Available | 2880 | Open in IMG/M |
3300026381|Ga0255357_1037306 | Not Available | 726 | Open in IMG/M |
3300026498|Ga0257156_1119659 | Not Available | 548 | Open in IMG/M |
3300026499|Ga0257181_1087369 | Not Available | 544 | Open in IMG/M |
3300026860|Ga0207823_115525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → unclassified Syntrophorhabdaceae → Syntrophorhabdaceae bacterium PtaU1.Bin034 | 510 | Open in IMG/M |
3300026932|Ga0207836_1001231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3338 | Open in IMG/M |
3300026934|Ga0207816_1012713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
3300026953|Ga0207835_1001513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2844 | Open in IMG/M |
3300026982|Ga0207854_1002082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2798 | Open in IMG/M |
3300027568|Ga0208042_1022605 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
3300027641|Ga0208827_1004099 | All Organisms → cellular organisms → Bacteria | 5845 | Open in IMG/M |
3300027641|Ga0208827_1034597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Sandaracinaceae → unclassified Sandaracinaceae → Sandaracinaceae bacterium | 1783 | Open in IMG/M |
3300027641|Ga0208827_1040903 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
3300027641|Ga0208827_1175919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 581 | Open in IMG/M |
3300027696|Ga0208696_1013791 | All Organisms → cellular organisms → Bacteria | 3190 | Open in IMG/M |
3300027853|Ga0209274_10167085 | Not Available | 1113 | Open in IMG/M |
3300027854|Ga0209517_10028898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4735 | Open in IMG/M |
3300027855|Ga0209693_10320807 | Not Available | 754 | Open in IMG/M |
3300027895|Ga0209624_10539615 | Not Available | 775 | Open in IMG/M |
3300027905|Ga0209415_10469829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
3300027908|Ga0209006_10199257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → Roseovarius confluentis | 1739 | Open in IMG/M |
3300028560|Ga0302144_10009918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3106 | Open in IMG/M |
3300028565|Ga0302145_10013760 | Not Available | 3009 | Open in IMG/M |
3300028566|Ga0302147_10015651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2810 | Open in IMG/M |
3300028652|Ga0302166_10136397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 565 | Open in IMG/M |
3300028653|Ga0265323_10002872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7737 | Open in IMG/M |
3300028653|Ga0265323_10021996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 2439 | Open in IMG/M |
3300028653|Ga0265323_10029098 | Not Available | 2068 | Open in IMG/M |
3300028673|Ga0257175_1051466 | Not Available | 755 | Open in IMG/M |
3300028748|Ga0302156_10034186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2860 | Open in IMG/M |
3300028762|Ga0302202_10043324 | All Organisms → cellular organisms → Bacteria | 3008 | Open in IMG/M |
3300028783|Ga0302279_10042685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2860 | Open in IMG/M |
3300028785|Ga0302201_10026788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3146 | Open in IMG/M |
3300028813|Ga0302157_10053853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2800 | Open in IMG/M |
3300028859|Ga0302265_1013109 | Not Available | 3347 | Open in IMG/M |
3300028874|Ga0302155_10025975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2829 | Open in IMG/M |
3300029882|Ga0311368_10113555 | All Organisms → cellular organisms → Bacteria | 2284 | Open in IMG/M |
3300029883|Ga0311327_10067663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2743 | Open in IMG/M |
3300029901|Ga0247051_1129155 | Not Available | 608 | Open in IMG/M |
3300029911|Ga0311361_10076882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4988 | Open in IMG/M |
3300029915|Ga0311358_10041618 | All Organisms → cellular organisms → Bacteria | 5444 | Open in IMG/M |
3300029915|Ga0311358_10102251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2927 | Open in IMG/M |
3300029939|Ga0311328_10385506 | Not Available | 1011 | Open in IMG/M |
3300029945|Ga0311330_10032562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5908 | Open in IMG/M |
3300029945|Ga0311330_10103176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2848 | Open in IMG/M |
3300029952|Ga0311346_10113611 | All Organisms → cellular organisms → Bacteria | 3394 | Open in IMG/M |
3300029954|Ga0311331_10059488 | All Organisms → cellular organisms → Bacteria | 5241 | Open in IMG/M |
3300029987|Ga0311334_10054502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2852 | Open in IMG/M |
3300029987|Ga0311334_11435663 | Not Available | 583 | Open in IMG/M |
3300029988|Ga0302190_10029640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2860 | Open in IMG/M |
3300029999|Ga0311339_10166869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2554 | Open in IMG/M |
3300030007|Ga0311338_10131357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3028 | Open in IMG/M |
3300030041|Ga0302274_10041979 | Not Available | 2777 | Open in IMG/M |
3300030519|Ga0302193_10042717 | Not Available | 3026 | Open in IMG/M |
3300030519|Ga0302193_10046501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2874 | Open in IMG/M |
3300030520|Ga0311372_11065387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1056 | Open in IMG/M |
3300030617|Ga0311356_11643845 | Not Available | 577 | Open in IMG/M |
3300030707|Ga0310038_10214039 | Not Available | 912 | Open in IMG/M |
3300030707|Ga0310038_10448486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300031234|Ga0302325_10340033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2394 | Open in IMG/M |
3300031235|Ga0265330_10022077 | Not Available | 2900 | Open in IMG/M |
3300031238|Ga0265332_10226803 | Not Available | 774 | Open in IMG/M |
3300031242|Ga0265329_10013525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2907 | Open in IMG/M |
3300031344|Ga0265316_10181214 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
3300031344|Ga0265316_10424514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
3300031344|Ga0265316_10468822 | Not Available | 902 | Open in IMG/M |
3300031524|Ga0302320_10204712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2816 | Open in IMG/M |
3300031524|Ga0302320_11118260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 819 | Open in IMG/M |
3300031525|Ga0302326_10147079 | All Organisms → cellular organisms → Bacteria | 4066 | Open in IMG/M |
3300031681|Ga0318572_10617615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 646 | Open in IMG/M |
3300031712|Ga0265342_10217931 | Not Available | 1029 | Open in IMG/M |
3300031712|Ga0265342_10697610 | Not Available | 507 | Open in IMG/M |
3300031788|Ga0302319_10074623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5125 | Open in IMG/M |
3300031879|Ga0306919_10997931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 640 | Open in IMG/M |
3300031938|Ga0308175_100425535 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
3300031996|Ga0308176_10097744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2567 | Open in IMG/M |
3300031996|Ga0308176_10195612 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
3300031997|Ga0315278_11301077 | Not Available | 708 | Open in IMG/M |
3300032035|Ga0310911_10210839 | Not Available | 1107 | Open in IMG/M |
3300032046|Ga0315289_10557242 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300032053|Ga0315284_12386422 | Not Available | 519 | Open in IMG/M |
3300032074|Ga0308173_10278984 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
3300032160|Ga0311301_10955079 | Not Available | 1143 | Open in IMG/M |
3300032160|Ga0311301_12336319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 606 | Open in IMG/M |
3300032261|Ga0306920_100211461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2894 | Open in IMG/M |
3300032342|Ga0315286_10115327 | Not Available | 2881 | Open in IMG/M |
3300032401|Ga0315275_12104230 | Not Available | 592 | Open in IMG/M |
3300033134|Ga0335073_11334685 | Not Available | 706 | Open in IMG/M |
3300033158|Ga0335077_11325205 | Not Available | 698 | Open in IMG/M |
3300033402|Ga0326728_10104046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3399 | Open in IMG/M |
3300033402|Ga0326728_10208965 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
3300033402|Ga0326728_10683646 | Not Available | 775 | Open in IMG/M |
3300033405|Ga0326727_10123914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3218 | Open in IMG/M |
3300033412|Ga0310810_10224644 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
3300033561|Ga0371490_1013915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2869 | Open in IMG/M |
3300033891|Ga0334811_009012 | Not Available | 2845 | Open in IMG/M |
3300034091|Ga0326724_0055269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2846 | Open in IMG/M |
3300034091|Ga0326724_0147873 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 10.12% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.17% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.23% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 5.06% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 4.67% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 4.28% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.89% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.11% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.11% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.72% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.72% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.33% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.33% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.95% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.95% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.95% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.95% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.95% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.17% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.17% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.17% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.17% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.17% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 1.17% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.78% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.39% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.39% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.39% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.39% |
Cryconite | Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite | 0.39% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.39% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.39% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.39% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.39% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.39% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.39% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.39% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.39% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.39% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.39% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.39% |
Drinking Water Pipes | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes | 0.39% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001454 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 | Environmental | Open in IMG/M |
3300002071 | Barrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002563 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006872 | Biofilm microbial communities from drinking water pipes in Singapore | Engineered | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009676 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG | Engineered | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022593 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W2 | Environmental | Open in IMG/M |
3300022835 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E2 10-14 | Environmental | Open in IMG/M |
3300022875 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 10-14 | Environmental | Open in IMG/M |
3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
3300023258 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34 | Environmental | Open in IMG/M |
3300024238 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T50 | Environmental | Open in IMG/M |
3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
3300025764 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes) | Environmental | Open in IMG/M |
3300025865 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026381 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T-25 | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026860 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 70 (SPAdes) | Environmental | Open in IMG/M |
3300026932 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 18 (SPAdes) | Environmental | Open in IMG/M |
3300026934 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 10 (SPAdes) | Environmental | Open in IMG/M |
3300026953 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 8 (SPAdes) | Environmental | Open in IMG/M |
3300026982 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 7 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Host-Associated | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
3300028859 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1 | Environmental | Open in IMG/M |
3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029901 | Cryconite microbial communities from ice sheet in Kangerlussuaq, Greenland - KAN_P-B3a | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300029988 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_102405542 | 3300000567 | Peatlands Soil | GIPMMSISHSELMPIGTERSDAGLYQCETVIDIRQEFSCFPLS* |
JGI12269J14319_100396903 | 3300001356 | Peatlands Soil | MMSISHSNLMPIRSERSDAGLSQFETVIDISQEFCLFSLS* |
JGI20204J15135_10010123 | 3300001454 | Arctic Peat Soil | MMSISRSEVMAISAERSDAKLFQCESVIDIRQGFWWF* |
JGIcombinedJ21915_101716632 | 3300002071 | Arctic Peat Soil | VLPXLRIPMMSISHSDLMPIRSERSDAGLSQCEIVIDIRQEFCLFSLS* |
JGIcombinedJ26739_1000948601 | 3300002245 | Forest Soil | RIPMMSISHSNLMPIRTERSDAGLSHCEIVIDISQGFGLFSLS* |
JGI24138J36424_100127713 | 3300002563 | Arctic Peat Soil | QXRIPMMSISHSDLMPIRSERSDAGLSQCEIVIDIRQEFCLFSLS* |
C688J35102_1194223282 | 3300002568 | Soil | RIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFCWFSLS* |
Ga0062388_1004157903 | 3300004635 | Bog Forest Soil | VRIPMMSISRSDLMSIRSERSDAELSQCEIVIDIRQEFCWFSLS* |
Ga0066673_108964441 | 3300005175 | Soil | LRIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQGFCWFSLS* |
Ga0066679_105924691 | 3300005176 | Soil | FGLRIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQESC* |
Ga0066388_1038704352 | 3300005332 | Tropical Forest Soil | MMSISHSDLMPISSERSDAGLSQCETVIDISQEFSLFPWL* |
Ga0070680_1014770251 | 3300005336 | Corn Rhizosphere | CLRIPMMSISHSDLMPIRTERSDVGLSQCEIVIGFRQEFCVFSLA* |
Ga0070675_1002253584 | 3300005354 | Miscanthus Rhizosphere | MMSISHSDLMPIRSERSDAGLSQCEIVIDIRQEFCLFSLSGFIGNLPFL |
Ga0070709_100889263 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VRIPMMSISHSDLVPISSERSDAGLSQCETVIDISQEFSLFA* |
Ga0066687_100734413 | 3300005454 | Soil | SVRIPMMSISHSDLMPIRTERSDAGLSQCETVIDIRQEFSCFSLF* |
Ga0070706_1011423451 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VRIPMMSISHSDLMPIRAERSDAGLSQCEVVIDIRQEFFC |
Ga0070706_1015524591 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPADRLLRIPMMSISHSDLMPIRAERSDAGLSQCEVVIDIRQEFFC |
Ga0070707_1014968422 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LRIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFCWFSLS* |
Ga0073909_100293293 | 3300005526 | Surface Soil | ISHSDLMPIRSERSDAGLSQFEIVIGISQDFCLFSLS* |
Ga0070741_100598551 | 3300005529 | Surface Soil | LRIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQAFWSFSLG* |
Ga0070734_102696812 | 3300005533 | Surface Soil | MMSISHSDLMPISSERSDAGLSQCETVIDISQEFSLFP* |
Ga0070735_101383673 | 3300005534 | Surface Soil | IPMMSISHSDLMPISSERSDAGLSQCETVIDISQDFSLFPWL* |
Ga0070684_1023221352 | 3300005535 | Corn Rhizosphere | IPMMSISHSDLMPIRAERSDAGPSQCETVIDISQEFCLFWLA* |
Ga0070733_107735102 | 3300005541 | Surface Soil | ISHSDLMPIRSERSDAGLSQFEVVIGISQYFCLFSLS* |
Ga0070665_1019718032 | 3300005548 | Switchgrass Rhizosphere | RIPMMSISHSDLMPISSERSDAGPSQCETVIDISQEFSLFPWL* |
Ga0066661_101950911 | 3300005554 | Soil | RIPMMSISHSDLMPISSERSDAGLSQCETVIDIRQEFCLPSLS* |
Ga0066702_106196982 | 3300005575 | Soil | LRIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQGFCWFSFS* |
Ga0068857_1003180401 | 3300005577 | Corn Rhizosphere | MMSISHSDLMPISSERSDAEPSQCETVIDISQEFLGLDA* |
Ga0070763_101479553 | 3300005610 | Soil | IPMMSISHSDLMPIRSERSDAGLSQFEIVIGISQGFCLFSLT* |
Ga0070763_108697692 | 3300005610 | Soil | GIPMMSITQSDLMPISAERSDAGLSQCERVIGMSQDVL* |
Ga0075276_100457181 | 3300005898 | Rice Paddy Soil | RIPMMSISHSDLMPIRSERSDAGLSQCEIVIGISQDFCSFSPP* |
Ga0070717_100417281 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MMSISHSDLMPISSERSDAGLSQCETVIDISQDFSLFPWL* |
Ga0075018_101902472 | 3300006172 | Watersheds | RIPMMSITQSDLMPISAERSDAGFSQCETVIGISQ* |
Ga0070765_1016081612 | 3300006176 | Soil | IPMMSITQSDLMPISTERSDAGPSQCELVIDISQ* |
Ga0075522_105463122 | 3300006638 | Arctic Peat Soil | LRIPMMAISRSEVMAISAERSDARLFQCESVIGIRQGF* |
Ga0075521_100144591 | 3300006642 | Arctic Peat Soil | MMSISHSDLMPIRSERSDAGLSQFEIVIGIRQDFCLFSLT* |
Ga0075521_106704712 | 3300006642 | Arctic Peat Soil | IPMMSISHSDLMPIRSERSDAGLSQCEIVIDIRQDFSLFSLI* |
Ga0066660_112642252 | 3300006800 | Soil | RIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFCLFSLS* |
Ga0101947_10435513 | 3300006872 | Drinking Water Pipes | VRIPMMSISHSNLMPISSERSDARLSQCESVIGIRQ* |
Ga0073928_100773174 | 3300006893 | Iron-Sulfur Acid Spring | RIPMMSISHSDLMPISSERSDARLSHCEIVIDISQEFCLFSLS* |
Ga0075424_1009476271 | 3300006904 | Populus Rhizosphere | MRIPMMSISHSDLMPISSERSDAGLSQCETVIDIRQEFSCFSLS* |
Ga0099830_108703133 | 3300009088 | Vadose Zone Soil | LRIPTKPISHSDLMPITYGRSDAELSQCGTVIDIRQQ |
Ga0099828_111898901 | 3300009089 | Vadose Zone Soil | LRIPTKPISHSDLMPITYGRSDAELSQCGTVIDIRQQFSVFPLNY |
Ga0066709_1036989942 | 3300009137 | Grasslands Soil | RIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFCVFSLS* |
Ga0105092_103281881 | 3300009157 | Freshwater Sediment | IPMMSISHSDLMPIRAERSDAGLSQCETVIDIRQ* |
Ga0114970_100636351 | 3300009163 | Freshwater Lake | MRIPMMPISQSDLMPISSEASNAGLSQCELVIGIRQGF |
Ga0105104_106285321 | 3300009168 | Freshwater Sediment | MMAISHSDLMPIRAERSDAGLSQCETVIDIRQEFWR |
Ga0116108_12246572 | 3300009519 | Peatland | RELRNPHLGIPMMSISHSDLMPIRAERSDAGLSQCETVIDIRQEFC* |
Ga0116222_13739801 | 3300009521 | Peatlands Soil | MNSSQRVRIPMMSISHSNLMPIRSERSDAGLSQFETVIDISQEFCLF |
Ga0116225_10270425 | 3300009524 | Peatlands Soil | VLRIPMMSISHSNLMPIRSERSDAGLSQFETVIDISQ |
Ga0116225_11456192 | 3300009524 | Peatlands Soil | LGIPMMSISHSELMPIGTERSDAGLYQCETVIDIRQEFSCFPLS* |
Ga0116111_10048003 | 3300009616 | Peatland | MMSISHSDLMPISAERSDAGLSQCETVIDIRQEFC* |
Ga0116126_10174844 | 3300009640 | Peatland | LLLRIPMMSISHSDLMPIRTERSDAGLCQCEIVIDIRQEFSCSSLS* |
Ga0116106_10959531 | 3300009645 | Peatland | MLVRIPMMSISHSDLMPIRSERSDAGLSQCETVIGISQDFCLFSLS* |
Ga0116187_10646261 | 3300009676 | Anaerobic Digestor Sludge | FAPSFLGIPMMSISHSDLMPIRAERSDAGLSQCETVIDIRQ* |
Ga0116134_10164524 | 3300009764 | Peatland | MRIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFSCSSLS* |
Ga0116219_100550293 | 3300009824 | Peatlands Soil | RIPMMSISHSNLMPIRSERSDAGLSQFETVIDISQEFCLFSLS* |
Ga0126384_102853341 | 3300010046 | Tropical Forest Soil | MFSLGVRIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQ |
Ga0126382_125179752 | 3300010047 | Tropical Forest Soil | MMSISHSDLMPISSERREAELSQFETVIDIRQGIFVFC* |
Ga0074045_100779761 | 3300010341 | Bog Forest Soil | RPPMRIPMMSISHSDLMPIRSERSDAGHFQREIVIGINQDFSLFSLT* |
Ga0074045_104523841 | 3300010341 | Bog Forest Soil | MMSISHSDLMPISSERCDAGLSQCETVIDIRQGSFF |
Ga0126376_121812441 | 3300010359 | Tropical Forest Soil | TMPISHSDLMPIRAERSDAGLSQFEIVIDIRQEYCCFSLS* |
Ga0126376_122512982 | 3300010359 | Tropical Forest Soil | VGITMMPISHSELMPISSERSDAGLSQCETVIDIRQEFCWFSFSS* |
Ga0126378_103236833 | 3300010361 | Tropical Forest Soil | RIPMMSISHSDLMPISSERSDAGLSQCETVIDISQEVSLFPWL* |
Ga0126378_106221593 | 3300010361 | Tropical Forest Soil | RIPMMSISHSDLMPISSERSDAGLSQCESVIDIRQGFLA* |
Ga0126379_123084161 | 3300010366 | Tropical Forest Soil | TLQHASGLRIPMMSISHSDLMPINSERSDAGLSQCESVIDIRQGFLA* |
Ga0136449_1000599531 | 3300010379 | Peatlands Soil | MMSISHSNLMPIRSERSDAGLSQFETVIDISQEFCL |
Ga0136449_1003232623 | 3300010379 | Peatlands Soil | GIPMMSISHSDLMPIRTERSDAGLSQCETVIGISQEVCWFSLS* |
Ga0136449_1025395372 | 3300010379 | Peatlands Soil | MMSISHSELMPIGTERSDAGLYQCETVIDIRQEFSCF |
Ga0134122_106740921 | 3300010400 | Terrestrial Soil | SIQALDAAYLRIPMMSISYSDPMPIRSERSDAGLSQCEIVIGISQDFCLFSLS* |
Ga0137393_111740342 | 3300011271 | Vadose Zone Soil | MENFVDSSLLRIPMMSISHSDLMPISSERSDAGLSQCETVIDIRQEFSLFSWS* |
Ga0137363_100045004 | 3300012202 | Vadose Zone Soil | MMSISHSDLMPIKSERSDAGLSQFEIVIAIRQDFCLFSLT* |
Ga0137363_103128373 | 3300012202 | Vadose Zone Soil | RIPMMSISHSDLMPIKSERRDAGLSQFEIVIAIRQDFCLFSLT* |
Ga0137362_100930303 | 3300012205 | Vadose Zone Soil | MMSISHSDLMPIKSERRDAGLSQFEIVIAIRQDFCLFSLT* |
Ga0137362_114607623 | 3300012205 | Vadose Zone Soil | LRIPTKPISHSDLMPITYGRSDAELSQCGTVIDIRQQFSVFPLNYL |
Ga0137360_100916681 | 3300012361 | Vadose Zone Soil | MMSISHSDLMPIKSERRDAGLSQFEIVIAIRQDFCLF |
Ga0138256_102123001 | 3300012533 | Active Sludge | MMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFCLF |
Ga0138256_107828961 | 3300012533 | Active Sludge | ISHSDLMPIRTERSDAGLSQCEIVIDIRQEFCLFSLS* |
Ga0138256_108845631 | 3300012533 | Active Sludge | MTRSDRPFLRIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFCL |
Ga0134081_103541552 | 3300014150 | Grasslands Soil | EPLVLNSGIKVRIPMMSISRSEVMAISAERSDAGLSQCESVIDIRQGFC* |
Ga0181530_104735591 | 3300014159 | Bog | MMSISRSEVMSISAERSDAGLSQCESAMGIRQEFEWFSLLST |
Ga0181529_100472031 | 3300014161 | Bog | VGIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC* |
Ga0181523_107868041 | 3300014165 | Bog | IPMMSISHSNLMPIRSERSDAELFQCETVIDISQEFCLFSLS* |
Ga0181531_109182302 | 3300014169 | Bog | VWIPMMSISHSDLMPIRSERSDAGLSQFEVVIGISQYFCLFSLS* |
Ga0181535_106889131 | 3300014199 | Bog | MRIPMMSISHSDLMPIRSERSDAGLSQCETVIGISQDFCLF |
Ga0181535_108675791 | 3300014199 | Bog | MMSISHSDLMPIRSERSDAGLSQCETVIGISQDFCLF |
Ga0181537_108611931 | 3300014201 | Bog | MGIPMMSITQSDLMPISAERSDAGLSQCERVIGMSQD |
Ga0182013_103936342 | 3300014492 | Bog | LRIPMMSISRSEVMAISAERSDARLFQCESVIGIRQGF* |
Ga0182016_100628184 | 3300014493 | Bog | MMSISRSEVMAISAERSDARLFQCESVIGIRQGF* |
Ga0182017_100497223 | 3300014494 | Fen | RIPMMSISHSDLMPIRSERSDAGHFQCETVIGISQDFSLFSLT* |
Ga0182011_100157251 | 3300014496 | Fen | LPELAINLRTPMMSISHSDLMPIRSERSDAGLSQFEALIDIRQEFC |
Ga0182011_100321921 | 3300014496 | Fen | MMSISHSDLMPIRSERSDAGHFQCETVIGISQDFSLF |
Ga0182011_106309391 | 3300014496 | Fen | MMSISHSDLMPIRSERSDAGHFQCETVIGISQDFSL |
Ga0182011_106777092 | 3300014496 | Fen | MMSISHSDLMPIRSERSDAGLSQCETVIGIRQEFC |
Ga0182019_100358593 | 3300014498 | Fen | RTPMMSISHSDLMPIRSERSDAGLSQFEALIDIRQEFCLPSLS* |
Ga0182012_107262601 | 3300014499 | Bog | RIPMMSISRSEVMAISAERSDARLFQCESVIGIRQGF* |
Ga0182021_101336784 | 3300014502 | Fen | GIPMMSISHSDLMPIRAERSDAGLSQCETVIDIRQ* |
Ga0182021_116843521 | 3300014502 | Fen | MMSISHSDLMPIRSERSDAGLSQCETVIGIRQEFCCFSL |
Ga0182021_123589693 | 3300014502 | Fen | METLGIPMMSISHSDLMPIRAERSDAGLSQCETVIDIRQ |
Ga0182021_125498252 | 3300014502 | Fen | PMMSISHSDLMPIRSERSDAGLSQFEALIDIRQEFCLPSLS* |
Ga0181536_100027241 | 3300014638 | Bog | MRIPMMSISHSDLMPIRTERSDAGLCQCEIVIDIRQEFSC |
Ga0181536_100067521 | 3300014638 | Bog | MRIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFSC |
Ga0181536_100121881 | 3300014638 | Bog | MMSISHSDLMPIRTERSDAGLCQCEIVIDIRQEFSCS |
Ga0181536_100212951 | 3300014638 | Bog | MRIPMMSISHSDLMPIRTERSDAGLCQCEIVIDIRQE |
Ga0181536_100600361 | 3300014638 | Bog | MLLLLRIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFSCS |
Ga0181536_101389221 | 3300014638 | Bog | MMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFSC |
Ga0181536_101448621 | 3300014638 | Bog | MRIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFSCS |
Ga0181519_102086843 | 3300014658 | Bog | CVLRIPMMSISHSDLMPISAERSDAGLSQCETVIGIRQEVCWFSLS* |
Ga0182030_101461503 | 3300014838 | Bog | IPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC* |
Ga0182030_101475553 | 3300014838 | Bog | MMAISHSEVMAISAERSDARLFQCESVIGIRQGF* |
Ga0182030_103862791 | 3300014838 | Bog | MMSISCSEVMAISAERSDARLFQCETVIDIRQGVCW |
Ga0182027_100414291 | 3300014839 | Fen | MGIPMMSISHSDLMPIRSERSDAGLSQCETVIGIRQEFCWF |
Ga0182027_101106064 | 3300014839 | Fen | GIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC* |
Ga0157376_130520971 | 3300014969 | Miscanthus Rhizosphere | VSLAICLRIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFCLLSLA* |
Ga0137405_10071263 | 3300015053 | Vadose Zone Soil | ILRIPMMAISRSEVMAISAERSDARLFQCESVIDIRQGICWFS* |
Ga0167658_100030529 | 3300015195 | Glacier Forefield Soil | MLNSLMLAFWLRIPMMSISQSDLMPIRSERSDARLSQCESVID |
Ga0167638_10620692 | 3300015197 | Glacier Forefield Soil | MAWLRIPMMSISHSNLMPIRTERSDAGLSQFEIVIDISQDFCLFSLP* |
Ga0180085_11488391 | 3300015259 | Soil | MMSISHSDLMPISSERSDARLSQCEGVIDIRQEFCLV |
Ga0137403_101068081 | 3300015264 | Vadose Zone Soil | RILRIPMMAISRSEVMAISAERSDARLFQCESVIDIRQGICWFS* |
Ga0182041_122096311 | 3300016294 | Soil | LRIPMMSISHSDLMPISSERSDAGLSQCETVIDIRQGFLAFS |
Ga0187818_102214872 | 3300017823 | Freshwater Sediment | VRIPMMSISHSDLMSIRTERSDAGLSQCEIVIDIRQEFSCSSLS |
Ga0187853_100259212 | 3300017940 | Peatland | MMSISHSDLMPISAERSDAGLSQCETVIDIRQEFC |
Ga0187808_105610961 | 3300017942 | Freshwater Sediment | VGIPVMSISHSDLMPIRAERSDAGLSLCETVIDIRQELCRFSLLWCEAGAFL |
Ga0187782_100584761 | 3300017975 | Tropical Peatland | RIPMMSISHSNLMPIRTERSDAGLSQCEIVIDIRQEFC |
Ga0181520_107290281 | 3300017988 | Bog | MMSISHSDLMPIRSERSDAGLSQCETVIGISQDFC |
Ga0187873_12243521 | 3300018013 | Peatland | EFRAEVRIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFSCSSLS |
Ga0187869_101517043 | 3300018030 | Peatland | RIPMMSISHSDLMPIRTERSDAGLCQCEIVIDIRQEFSCSSLS |
Ga0187863_104594431 | 3300018034 | Peatland | MSISHSDLMPIRSERSDAGLSQCETVIGISQDFCL |
Ga0187875_104807461 | 3300018035 | Peatland | MLRIPMMSISRSDLMPIRAERSDAGLSQCETVIDIRQELWRFSLL |
Ga0187859_102931112 | 3300018047 | Peatland | FMRIPMMPISHSDLMPIRSERSDAGLSQCEIVIDIRQEFCLFSLS |
Ga0187859_104889781 | 3300018047 | Peatland | IPMMSISHSDLMPIRSERSDAGLSQFEVVIGISQYFCLFSLS |
Ga0187784_105357142 | 3300018062 | Tropical Peatland | MMSISHSDPMPIRTERSDAELFQCETVIDIRQEFSGFSVD |
Ga0187771_113756072 | 3300018088 | Tropical Peatland | GRAVVGIPMMSISHSDLMPIRTERSDAELFQCETVIDIRQEFSGFSVF |
Ga0066662_110681351 | 3300018468 | Grasslands Soil | RIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFCWFSMA |
Ga0066662_123957111 | 3300018468 | Grasslands Soil | MMSISHSDLMPIRTERSDAGLSQCETVIDIRQEFSC |
Ga0182028_14240671 | 3300019788 | Fen | MRTPMMSISHSDLMPIRSERSDAGLSQFEALIDIRQ |
Ga0163153_100450801 | 3300020186 | Freshwater Microbial Mat | SNSLRIPMMPISHSDLMPIRSERSDAGLPQCELVIGIRQ |
Ga0210386_116138712 | 3300021406 | Soil | DEIWLRIPMMSISHSDLMPIRSERSDAGLSQFEVVIGISQYFCLFSLS |
Ga0210391_107698732 | 3300021433 | Soil | GIPMMSITQSDLMPISAERSDAGLSQCERVIGMSQDVL |
Ga0210392_102414031 | 3300021475 | Soil | HVQLRIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQEFCLFSLS |
Ga0187846_101046601 | 3300021476 | Biofilm | MPISHSDLMPIRAERSDAGLSQCEIVIDIRQEFCWFSFSGF |
Ga0126371_112739283 | 3300021560 | Tropical Forest Soil | MMSISHSDLMPISSERSDAGLSQCETVIDIRQGSF |
Ga0236338_10225793 | 3300022593 | Freshwater | RIPMMSISHSDLMPIRTERSDAGLSQCETVIDIRQEFPWFSLS |
Ga0224537_10112401 | 3300022835 | Soil | PMMSISHSDLMPISAERSDAGLSQCETVIDIRQEFCWFSLS |
Ga0224553_10094371 | 3300022875 | Soil | LGIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0224554_11237632 | 3300023068 | Soil | MMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0224535_10811381 | 3300023258 | Soil | LQTERALRTPMMSISHSDLMPIRSERSDAGLSQFEALIDIRQEFCLPSLS |
Ga0224523_10041934 | 3300024238 | Soil | MSISHSDLMPIRSERSDAGHFQCETVIGISQDFSLFSLT |
Ga0224523_10758311 | 3300024238 | Soil | LRVRIPMMSIRSERSDAGLSQFETLIDIRQEFSLPSLS |
Ga0208080_10524631 | 3300025553 | Arctic Peat Soil | IPMMSISHSDLMPIRSERSDAGLSQCETVIDIRQGFCWFSLS |
Ga0208480_10041785 | 3300025633 | Arctic Peat Soil | MMSISRSEVMAISAERSDAKLFQCESVIDIRQGFWWF |
Ga0209638_10850013 | 3300025725 | Arctic Peat Soil | DSRKPVKVRIPMMSISHSDLMPIRSERSDAGLSQCEIVIDIRQEFCLFSLS |
Ga0209539_10381911 | 3300025764 | Arctic Peat Soil | SALRKRLRIPMMSITHSDLMPIRSERSDAGLSQCEIVIDIRQDFCLFALT |
Ga0209226_101524352 | 3300025865 | Arctic Peat Soil | KLRIPMMSISHSDLMPIRSERSDAGLSQCEIVIGISQDFCLFSLS |
Ga0209584_100113963 | 3300025878 | Arctic Peat Soil | MMSISHSDLMPIRSERSDAGLSQFEIVIGIRQDFCLFSLT |
Ga0207707_100733141 | 3300025912 | Corn Rhizosphere | QVYSLRLLRIPMMSISHSDLMPIRTERSDVGLSQCEIVIGFRQEFCVFSLA |
Ga0207695_100169931 | 3300025913 | Corn Rhizosphere | ALVRIPTMSISRSEVMSISAERSDARLSECESVIDIRQELDWFSSP |
Ga0209237_10335894 | 3300026297 | Grasslands Soil | GSLRIPMMSISHSDLMPISSERSDAGLSQCETVIDIRQEFSLFSWS |
Ga0255357_10024444 | 3300026381 | Soil | CSRVPGVRIPMMSISHSDLMPIRSERSDAGHFQCETVIGISQDFSLFSLT |
Ga0255357_10373061 | 3300026381 | Soil | ERLVGIPMMSISHSDLMPIRSERSDAGLSQCETVIGIRQEFCWFSLS |
Ga0257156_11196591 | 3300026498 | Soil | LRIPMMSISHSDLMPIKSERRDAGLSQFEIVIAIRQDFCLFSLT |
Ga0257181_10873692 | 3300026499 | Soil | KSVRIPMMSISHSDLMPIKSERRDAGLSQFEIVIAIRQDFCLFSLT |
Ga0207823_1155251 | 3300026860 | Tropical Forest Soil | HSFGTVRIPMMSISHSDLMPISSERSDAGLSQFEIVIGISQDFCWFSLS |
Ga0207836_10012312 | 3300026932 | Tropical Forest Soil | MMSISHSDLMPIRSERSDAGLSQFEIVIGIRQDFCLFSVS |
Ga0207816_10127131 | 3300026934 | Tropical Forest Soil | LVRIPMMSISHSDLMPIRSERSDAGLSQFEIVIGIRQDFCLFSVS |
Ga0207835_10015131 | 3300026953 | Tropical Forest Soil | CLRIPMMSISHSDLMPIRSERSDAGLSQFEIVIGIRQDFCLFSVS |
Ga0207854_10020823 | 3300026982 | Tropical Forest Soil | TLRIPMMSISHSDLMPIRTERSDAGLSQFEIVIGIRQDFCLFSVS |
Ga0208042_10226053 | 3300027568 | Peatlands Soil | VRIPMMSISHSNLMPIRSERSDAGLSQFETVIDISQEFCLFSLS |
Ga0208827_10040998 | 3300027641 | Peatlands Soil | RIPMMSISHSNLMPIRSERSDAGLSQFETVIDISQEFCLFSLS |
Ga0208827_10345971 | 3300027641 | Peatlands Soil | MMSISHSNLMPIRSERSDAGLSQFETVIDISQEFCLFS |
Ga0208827_10409031 | 3300027641 | Peatlands Soil | MRIPMMSISHSNLMPIRSERSDAGLSQFETVIDISQEFCLFS |
Ga0208827_11759191 | 3300027641 | Peatlands Soil | VLRIPMMSISHSNLMPIRSERSDAGLSQFETVIDI |
Ga0208696_10137911 | 3300027696 | Peatlands Soil | NSSQRVRIPMMSISHSNLMPIRSERSDAGLSQFETVIDISQEFCLFSLS |
Ga0209274_101670853 | 3300027853 | Soil | HCLLRIPMMSISHSDLMPIRSERSDAGLSQFEVVIGISQYFCLFSLS |
Ga0209517_100288983 | 3300027854 | Peatlands Soil | MMSISHSELMPIGTERSDAGLYQCETVIDIRQEFSCFPLS |
Ga0209693_103208071 | 3300027855 | Soil | VRIPMMSITQSDLMPISAERSDAGLSQCERVIGMSQDVL |
Ga0209624_105396152 | 3300027895 | Forest Soil | IRLGIPMMSITQSDLMPISAERSDAGLSQCERVIGMSQDVL |
Ga0209415_104698291 | 3300027905 | Peatlands Soil | LRIPMMSISHSNLMPIRSERSDAGLSQFETVIDISQEFCLFSLS |
Ga0209006_101992572 | 3300027908 | Forest Soil | TSPGSDVGIPMMSITQSDLMPISAERSDAGLSQCERVIGMSQDVL |
Ga0302144_100099183 | 3300028560 | Bog | EYLRIPMMSISRSEVMAISAERSDARLSQCESVIGIRQGF |
Ga0302145_100137604 | 3300028565 | Bog | RLRIPMMSISRSEVMAISAERSDARLSQCESVIGIRQGF |
Ga0302147_100156513 | 3300028566 | Bog | RLGIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0302166_101363971 | 3300028652 | Fen | MMSISHSDLMPIRSERSDAGLSQFEIVIGIRQAFAWFP |
Ga0265323_100028721 | 3300028653 | Rhizosphere | MSMRIPMMSISHSDLMPIRSERSDAGLFQCEVVIDIR |
Ga0265323_100219963 | 3300028653 | Rhizosphere | MRIPMMSISHSDLMPIRSERSDAGLFQCEVVIDIRQ |
Ga0265323_100290983 | 3300028653 | Rhizosphere | MMSISHSDLMPIRSERSDAGLFQCEVVIDIRQDFSLCS |
Ga0257175_10514662 | 3300028673 | Soil | VGDYVRIPMMSISHSDLMPIKSERRDAGLSQFEIVIAIRQDFCLFSLT |
Ga0302156_100341861 | 3300028748 | Bog | MIARIGPALGIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0302202_100433241 | 3300028762 | Bog | MASVGIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0302279_100426854 | 3300028783 | Bog | VHHLGIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0302201_100267881 | 3300028785 | Bog | SGTGFPMKLRIPMMSISRSEVMAISAERSDARLSQCESVIGIRQGF |
Ga0302157_100538531 | 3300028813 | Bog | SVGIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0302265_10131094 | 3300028859 | Bog | LDVVRIPMMSISRSEVMAISAERSDARLSQCESVIGIRQGF |
Ga0302155_100259751 | 3300028874 | Bog | LSCRASFAYVGIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0311368_101135551 | 3300029882 | Palsa | TEAGMRIPMMSISRSEVMAISAERSDARLFQCESVIGIRQGF |
Ga0311327_100676633 | 3300029883 | Bog | RIPMMSISRSEVMAISAERSDARLSQCESVIGIRQGF |
Ga0247051_11291552 | 3300029901 | Cryconite | VRIPMMSISRSDVMAISAERSDARLFQCETVIDIRQGF |
Ga0311361_100768826 | 3300029911 | Bog | GHSLKLGIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0311358_100416184 | 3300029915 | Bog | LRIPMMSISRSEVMAISAERSDARLSQCESVIGIRQGF |
Ga0311358_101022514 | 3300029915 | Bog | KHKVGIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0311328_103855063 | 3300029939 | Bog | MRIPMMSISRSEVMAISAERSDARLSQCESVIGIR |
Ga0311330_100325621 | 3300029945 | Bog | VRIPMMSISRSEVMAISAERSDARLSQCESVIGIRQGF |
Ga0311330_101031764 | 3300029945 | Bog | LGWDDFVGIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0311346_101136111 | 3300029952 | Bog | KDSGAEGVGIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0311331_1005948810 | 3300029954 | Bog | MRIPMMSISRSEVMAISAERSDARLSQCESVIGIRQGF |
Ga0311334_100545021 | 3300029987 | Fen | AEPGRKLRLAESHLGIPMMSISHSDLMPIRSERSDAGLSQCETVIGIRQDFCLFSLS |
Ga0311334_114356632 | 3300029987 | Fen | MMSISHSDLMPIRSERSDAGLSQFEIVIGIRQDFCFSSLA |
Ga0302190_100296401 | 3300029988 | Bog | VVRIPMMSISRSEVMAISAERSDARLSQCESVIGIRQGF |
Ga0311339_101668693 | 3300029999 | Palsa | DSLRIPMMSISRSEVMAISAERSDARLFQCESVIGIRQGF |
Ga0311338_101313574 | 3300030007 | Palsa | VRIPMMSISRSEVMAISAERSDARLFQCESVIGIRQGF |
Ga0302274_100419791 | 3300030041 | Bog | HVLLRIPMMSISRSEVMAISAERSDARLSQCESVIGIRQGF |
Ga0302193_100427174 | 3300030519 | Bog | PFAQMRIPMMSISRSEVMAISAERSDARLSQCESVIGIRQGF |
Ga0302193_100465011 | 3300030519 | Bog | VPAPHVRIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0311372_110653871 | 3300030520 | Palsa | DVRIPMMSISRSEVMAISAERSDARLFQCESVIGIRQGF |
Ga0311356_116438451 | 3300030617 | Palsa | IPMMAISRSDVMAISAERSDARLSQCEAVIDIRQGFR |
Ga0311354_104372431 | 3300030618 | Palsa | PVFILATSLGIPMMSISHSDLMPISSERSDAEHFQCETVIDIRQDFLLFSWV |
Ga0310038_102140391 | 3300030707 | Peatlands Soil | MMSISHSNLMPIRSERSDAGLSQFETVIDISQEFCLF |
Ga0310038_104484863 | 3300030707 | Peatlands Soil | MMSISHSNLMPIRSERSDAGLSQFETVIDISQEFC |
Ga0302325_103400333 | 3300031234 | Palsa | SVGIPMMSISHSDLMPISSERSDAEHFQCETVIDIRQDFLLFSWV |
Ga0265330_100220774 | 3300031235 | Rhizosphere | MMSISHSDLMPIRSERSDAGLSQFEILIGISQDFCLFSLS |
Ga0265332_102268032 | 3300031238 | Rhizosphere | GFESHGRLRIPMMSISHSNLMPIRTERSDAGLSQFGLVIDISQDFCLFSLS |
Ga0265329_100135253 | 3300031242 | Rhizosphere | KVAFSVRIPMMSISHSDLMPIRSERSDAGLFQCEVVIDIRQDFSLCSLA |
Ga0265316_101812141 | 3300031344 | Rhizosphere | LRIPMMSISHSDLMPIRSERSDAGLSQFEILIGISQDFCLFSLS |
Ga0265316_104245141 | 3300031344 | Rhizosphere | HLNRLCFLGIPMMSISHSDLMPIRSERSDAGLSQCETVIGIRQEFC |
Ga0265316_104688221 | 3300031344 | Rhizosphere | QRGCCLRIPMMSISHSDLMPIRAERSDAGLSQCETVIDIRQDFLRFSLP |
Ga0302320_102047121 | 3300031524 | Bog | KDTGLEVHVGIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0302320_111182601 | 3300031524 | Bog | MKGVPPQLRIPMMSISHSDLMPIRAERSDAGLSQFE |
Ga0302326_101470794 | 3300031525 | Palsa | MMSISHSDLMPISSERSDAEHFQCETVIDIRQDFLLFSWV |
Ga0318572_106176151 | 3300031681 | Soil | PRFGKRFCLRIPLMSISHSDLMPISSERSDAGLSQCETVIDIRQ |
Ga0265342_102179313 | 3300031712 | Rhizosphere | LGGCKVGIPMMSISHSDLMPIRSERSDAGLSQCETVIGIRQEFC |
Ga0265342_106976101 | 3300031712 | Rhizosphere | MRIPMMSISHSDLMPIRSERSDAGLFQCEVVIDIRQD |
Ga0302319_100746231 | 3300031788 | Bog | RARLTLGIPMMSISHSDLMPISAERSDAGLSQCETMIGIRQEFC |
Ga0306919_109979311 | 3300031879 | Soil | GIPMMSISHSDLILIRTERSDAGLSQCETVIDIRQEFSQFFWS |
Ga0308175_1004255351 | 3300031938 | Soil | LRIPMMSISHSDLMPISSERSDAGLSQCETVIDISQDFSLFPWL |
Ga0308176_100977441 | 3300031996 | Soil | PMMSISQSNLMPISSERSDAKLSQCETVIDISQDFRCIS |
Ga0308176_101956123 | 3300031996 | Soil | QCCLRIPMMSISHSDLMPISSERSDAEPFQFETVIGISQELLGVSWF |
Ga0315278_113010771 | 3300031997 | Sediment | VRIPMMPISRSDLMPIRSERSDAGLFQCETVIDIRQGVCLFFSS |
Ga0310911_102108393 | 3300032035 | Soil | HSDLMPIRAERSDAGLSQCEIVIDIRQEVCLFSLC |
Ga0315289_105572421 | 3300032046 | Sediment | MMSISHSDLMPIRSERSDAGLSQCETVIDIRQGVC |
Ga0315284_123864222 | 3300032053 | Sediment | LHLRIPMMPISHSDLMPIRSERSDAGLSQCETVIDIRQGVCLFFSS |
Ga0308173_102789841 | 3300032074 | Soil | NGHHRGQAFVLLRIPMMSISHSDLMPISSERSDAGLSQCETVIDISQEFSVFPWL |
Ga0311301_109550791 | 3300032160 | Peatlands Soil | MMSISHSDLMPIRTERSDAGLSQCETVIGISQEVCWF |
Ga0311301_123363192 | 3300032160 | Peatlands Soil | VLRIPMMSISHSNLMPIRSERSDAGLSQFETVIDISQEFCLFS |
Ga0306920_1002114611 | 3300032261 | Soil | LGIPMMSISHSDLILIRTERSDAGLSQCETVIDIRQEFSQFFCS |
Ga0315286_101153271 | 3300032342 | Sediment | PMMSISHSDLMPIRTERSDAGLSQCETVIDIRQEFCLFSLS |
Ga0315275_121042302 | 3300032401 | Sediment | LRIPMMSISQSDLMPIRTERSDAGLSQCETVIDIRQEFCLFSLS |
Ga0335073_113346851 | 3300033134 | Soil | MSISHSDLMPISSERSDAGLSQCETVIDIRQGFSGSS |
Ga0335077_113252051 | 3300033158 | Soil | MMSISHSDLMPISSERSDAGLSQCETVIDISQEVS |
Ga0326728_101040461 | 3300033402 | Peat Soil | VTFRIPMMSISHSDLMPIRTERSDAGLCQCEIVIDIRQE |
Ga0326728_102089651 | 3300033402 | Peat Soil | VRIPMMSISHSDLMPIRTERSDAGLCQCEIVIDIRQEFSCSSLS |
Ga0326728_106836461 | 3300033402 | Peat Soil | MLPAQLRIPMMSISHSDLMPIRTERSDAGLSQCEIVID |
Ga0326727_101239146 | 3300033405 | Peat Soil | VTFRIPMMSISHSDLMPIRTERSDAGLCQCEIVIDIRQEF |
Ga0310810_102246441 | 3300033412 | Soil | RIPMMSISHSDLMPIRTERSDAGLSQCEIVIDIRQ |
Ga0371490_10139151 | 3300033561 | Peat Soil | AVYGKTLSPRHLLRIPMMSISHSDLMPIRTERSDAGLCQCEIVIDIRQEFSCSSLS |
Ga0334811_009012_2698_2844 | 3300033891 | Soil | RIGPLRIPMMSISHSDLMPIRSERSDAGHFQCETVIGISQDFSLFSLT |
Ga0326724_0055269_2712_2846 | 3300034091 | Peat Soil | FRIPMMSISHSDLMPIRTERSDAGLCQCEIVIDIRQEFSCSSLS |
Ga0326724_0147873_2_133 | 3300034091 | Peat Soil | MTFRIPMMSISHSDLMPIRTERSDAGLCQCEIVIDIRQEFSCSS |
⦗Top⦘ |