Basic Information | |
---|---|
Family ID | F015420 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 255 |
Average Sequence Length | 42 residues |
Representative Sequence | MKRLINYFTPVGEEQIAFAKAMLIVTTVTLSILFLFTFLELIL |
Number of Associated Samples | 145 |
Number of Associated Scaffolds | 255 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.18 % |
% of genes near scaffold ends (potentially truncated) | 15.69 % |
% of genes from short scaffolds (< 2000 bps) | 77.65 % |
Associated GOLD sequencing projects | 125 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (69.020 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (21.961 % of family members) |
Environment Ontology (ENVO) | Unclassified (64.314 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.490 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 255 Family Scaffolds |
---|---|---|
PF13482 | RNase_H_2 | 9.41 |
PF13392 | HNH_3 | 9.02 |
PF08299 | Bac_DnaA_C | 5.49 |
PF13539 | Peptidase_M15_4 | 3.53 |
PF05105 | Phage_holin_4_1 | 1.18 |
PF08279 | HTH_11 | 0.78 |
PF00145 | DNA_methylase | 0.78 |
PF16677 | GP3_package | 0.78 |
PF04404 | ERF | 0.78 |
PF10544 | T5orf172 | 0.39 |
PF14550 | Peptidase_S78_2 | 0.39 |
COG ID | Name | Functional Category | % Frequency in 255 Family Scaffolds |
---|---|---|---|
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 5.49 |
COG4824 | Phage-related holin (Lysis protein) | Mobilome: prophages, transposons [X] | 1.18 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 69.02 % |
All Organisms | root | All Organisms | 30.98 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2149837002|Baltic_Sea__contig32204 | Not Available | 688 | Open in IMG/M |
3300000124|BS_KBA_SWE12_21mDRAFT_c10003856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5259 | Open in IMG/M |
3300000124|BS_KBA_SWE12_21mDRAFT_c10004137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5053 | Open in IMG/M |
3300000124|BS_KBA_SWE12_21mDRAFT_c10004408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4889 | Open in IMG/M |
3300000124|BS_KBA_SWE12_21mDRAFT_c10054269 | Not Available | 1068 | Open in IMG/M |
3300000126|BS_KBB_SWE26_205mDRAFT_c1003194 | Not Available | 3026 | Open in IMG/M |
3300000756|JGI12421J11937_10011607 | Not Available | 3370 | Open in IMG/M |
3300000756|JGI12421J11937_10018746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2570 | Open in IMG/M |
3300000792|BS_KBA_SWE02_21mDRAFT_10186028 | Not Available | 506 | Open in IMG/M |
3300002098|JGI24219J26650_1019924 | Not Available | 919 | Open in IMG/M |
3300002302|B570J29635_1001052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2020 | Open in IMG/M |
3300002397|B570J29612_1001356 | All Organisms → Viruses → Predicted Viral | 2456 | Open in IMG/M |
3300002397|B570J29612_1002909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1702 | Open in IMG/M |
3300002835|B570J40625_101146676 | Not Available | 654 | Open in IMG/M |
3300003277|JGI25908J49247_10035701 | Not Available | 1376 | Open in IMG/M |
3300003277|JGI25908J49247_10075511 | Not Available | 838 | Open in IMG/M |
3300003277|JGI25908J49247_10099444 | Not Available | 701 | Open in IMG/M |
3300003277|JGI25908J49247_10112659 | Not Available | 648 | Open in IMG/M |
3300003388|JGI25910J50241_10000512 | Not Available | 12990 | Open in IMG/M |
3300003393|JGI25909J50240_1047691 | Not Available | 897 | Open in IMG/M |
3300003393|JGI25909J50240_1055936 | Not Available | 813 | Open in IMG/M |
3300003394|JGI25907J50239_1032169 | Not Available | 1118 | Open in IMG/M |
3300003394|JGI25907J50239_1095968 | Not Available | 579 | Open in IMG/M |
3300003404|JGI25920J50251_10044813 | Not Available | 1205 | Open in IMG/M |
3300003497|JGI25925J51416_10129575 | Not Available | 584 | Open in IMG/M |
3300004096|Ga0066177_10474979 | Not Available | 551 | Open in IMG/M |
3300004792|Ga0007761_10745506 | Not Available | 517 | Open in IMG/M |
3300004836|Ga0007759_11469724 | Not Available | 605 | Open in IMG/M |
3300005580|Ga0049083_10029482 | All Organisms → cellular organisms → Bacteria | 1959 | Open in IMG/M |
3300005580|Ga0049083_10065708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1271 | Open in IMG/M |
3300005580|Ga0049083_10094863 | Not Available | 1035 | Open in IMG/M |
3300005581|Ga0049081_10035290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1901 | Open in IMG/M |
3300005581|Ga0049081_10065138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1371 | Open in IMG/M |
3300005581|Ga0049081_10144119 | Not Available | 874 | Open in IMG/M |
3300005581|Ga0049081_10159261 | Not Available | 823 | Open in IMG/M |
3300005581|Ga0049081_10291183 | Not Available | 564 | Open in IMG/M |
3300005583|Ga0049085_10230685 | Not Available | 609 | Open in IMG/M |
3300005584|Ga0049082_10054528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1402 | Open in IMG/M |
3300005584|Ga0049082_10070776 | Not Available | 1224 | Open in IMG/M |
3300005584|Ga0049082_10086244 | Not Available | 1101 | Open in IMG/M |
3300005585|Ga0049084_10173143 | Not Available | 745 | Open in IMG/M |
3300005585|Ga0049084_10307165 | Not Available | 526 | Open in IMG/M |
3300005805|Ga0079957_1024989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4068 | Open in IMG/M |
3300005940|Ga0073913_10002253 | All Organisms → cellular organisms → Bacteria | 2605 | Open in IMG/M |
3300005940|Ga0073913_10002743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2345 | Open in IMG/M |
3300005940|Ga0073913_10011637 | Not Available | 1201 | Open in IMG/M |
3300006484|Ga0070744_10005192 | Not Available | 3908 | Open in IMG/M |
3300006484|Ga0070744_10143503 | Not Available | 686 | Open in IMG/M |
3300006805|Ga0075464_10477074 | Not Available | 762 | Open in IMG/M |
3300006805|Ga0075464_10636754 | Not Available | 657 | Open in IMG/M |
3300006805|Ga0075464_10953624 | Not Available | 537 | Open in IMG/M |
3300006920|Ga0070748_1289652 | Not Available | 583 | Open in IMG/M |
3300007540|Ga0099847_1043911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1416 | Open in IMG/M |
3300007540|Ga0099847_1229152 | Not Available | 537 | Open in IMG/M |
3300007636|Ga0102856_1031176 | Not Available | 810 | Open in IMG/M |
3300007735|Ga0104988_10842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33213 | Open in IMG/M |
3300007973|Ga0105746_1358746 | Not Available | 509 | Open in IMG/M |
3300008055|Ga0108970_11361540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
3300008122|Ga0114359_1019472 | Not Available | 2784 | Open in IMG/M |
3300008259|Ga0114841_1200858 | Not Available | 720 | Open in IMG/M |
3300008259|Ga0114841_1228665 | Not Available | 636 | Open in IMG/M |
3300008450|Ga0114880_1116847 | Not Available | 1008 | Open in IMG/M |
3300008450|Ga0114880_1157330 | Not Available | 811 | Open in IMG/M |
3300008450|Ga0114880_1164001 | Not Available | 785 | Open in IMG/M |
3300008450|Ga0114880_1269874 | Not Available | 517 | Open in IMG/M |
3300008450|Ga0114880_1275717 | Not Available | 507 | Open in IMG/M |
3300008999|Ga0102816_1083371 | Not Available | 969 | Open in IMG/M |
3300009026|Ga0102829_1064400 | Not Available | 1112 | Open in IMG/M |
3300009026|Ga0102829_1303009 | Not Available | 532 | Open in IMG/M |
3300009068|Ga0114973_10125796 | Not Available | 1439 | Open in IMG/M |
3300009068|Ga0114973_10470719 | Not Available | 653 | Open in IMG/M |
3300009149|Ga0114918_10579572 | Not Available | 595 | Open in IMG/M |
3300009155|Ga0114968_10014802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5494 | Open in IMG/M |
3300009158|Ga0114977_10052290 | All Organisms → cellular organisms → Bacteria | 2528 | Open in IMG/M |
3300009158|Ga0114977_10175551 | Not Available | 1266 | Open in IMG/M |
3300009158|Ga0114977_10247376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1030 | Open in IMG/M |
3300009159|Ga0114978_10161397 | All Organisms → Viruses → Predicted Viral | 1438 | Open in IMG/M |
3300009159|Ga0114978_10453846 | Not Available | 759 | Open in IMG/M |
3300009161|Ga0114966_10405566 | Not Available | 797 | Open in IMG/M |
3300009161|Ga0114966_10806210 | Not Available | 506 | Open in IMG/M |
3300009163|Ga0114970_10046210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2832 | Open in IMG/M |
3300009163|Ga0114970_10059776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2436 | Open in IMG/M |
3300009163|Ga0114970_10074410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2141 | Open in IMG/M |
3300009163|Ga0114970_10285575 | Not Available | 943 | Open in IMG/M |
3300009180|Ga0114979_10209070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1180 | Open in IMG/M |
3300009181|Ga0114969_10066524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2374 | Open in IMG/M |
3300009185|Ga0114971_10528556 | Not Available | 657 | Open in IMG/M |
3300009187|Ga0114972_10290360 | Not Available | 973 | Open in IMG/M |
3300010340|Ga0116250_10231542 | Not Available | 1119 | Open in IMG/M |
3300010885|Ga0133913_12004827 | All Organisms → Viruses → Predicted Viral | 1438 | Open in IMG/M |
3300010885|Ga0133913_12710187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1198 | Open in IMG/M |
3300011010|Ga0139557_1062464 | Not Available | 625 | Open in IMG/M |
3300011335|Ga0153698_1026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 60109 | Open in IMG/M |
3300013004|Ga0164293_10145066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1770 | Open in IMG/M |
3300013372|Ga0177922_10241704 | Not Available | 617 | Open in IMG/M |
3300013372|Ga0177922_10418976 | Not Available | 509 | Open in IMG/M |
3300013372|Ga0177922_11134883 | Not Available | 579 | Open in IMG/M |
3300015050|Ga0181338_1059036 | Not Available | 553 | Open in IMG/M |
3300017699|Ga0181345_101977 | Not Available | 805 | Open in IMG/M |
3300017701|Ga0181364_1008838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1709 | Open in IMG/M |
3300017701|Ga0181364_1056534 | Not Available | 610 | Open in IMG/M |
3300017722|Ga0181347_1161416 | Not Available | 607 | Open in IMG/M |
3300017723|Ga0181362_1086486 | Not Available | 630 | Open in IMG/M |
3300017736|Ga0181365_1108586 | Not Available | 669 | Open in IMG/M |
3300017754|Ga0181344_1074883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
3300017766|Ga0181343_1134815 | Not Available | 691 | Open in IMG/M |
3300017766|Ga0181343_1199880 | Not Available | 548 | Open in IMG/M |
3300017774|Ga0181358_1219902 | Not Available | 612 | Open in IMG/M |
3300017774|Ga0181358_1254749 | Not Available | 551 | Open in IMG/M |
3300017778|Ga0181349_1209608 | Not Available | 669 | Open in IMG/M |
3300017780|Ga0181346_1305846 | Not Available | 538 | Open in IMG/M |
3300017784|Ga0181348_1217343 | Not Available | 676 | Open in IMG/M |
3300017785|Ga0181355_1058974 | Not Available | 1622 | Open in IMG/M |
3300019784|Ga0181359_1025624 | Not Available | 2257 | Open in IMG/M |
3300019784|Ga0181359_1056854 | Not Available | 1502 | Open in IMG/M |
3300019784|Ga0181359_1095930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1093 | Open in IMG/M |
3300019784|Ga0181359_1161585 | Not Available | 758 | Open in IMG/M |
3300019784|Ga0181359_1183260 | Not Available | 689 | Open in IMG/M |
3300019784|Ga0181359_1193280 | Not Available | 661 | Open in IMG/M |
3300019784|Ga0181359_1210571 | Not Available | 619 | Open in IMG/M |
3300019784|Ga0181359_1253608 | Not Available | 532 | Open in IMG/M |
3300019784|Ga0181359_1272559 | Not Available | 501 | Open in IMG/M |
3300020141|Ga0211732_1447427 | Not Available | 726 | Open in IMG/M |
3300020151|Ga0211736_10205304 | Not Available | 1298 | Open in IMG/M |
3300020159|Ga0211734_11067570 | Not Available | 897 | Open in IMG/M |
3300020160|Ga0211733_11158964 | Not Available | 832 | Open in IMG/M |
3300020161|Ga0211726_10097479 | Not Available | 722 | Open in IMG/M |
3300020161|Ga0211726_10764654 | Not Available | 703 | Open in IMG/M |
3300020205|Ga0211731_10709771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2022 | Open in IMG/M |
3300020205|Ga0211731_11613684 | Not Available | 831 | Open in IMG/M |
3300020510|Ga0208086_1039697 | Not Available | 538 | Open in IMG/M |
3300020525|Ga0207938_1000122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13045 | Open in IMG/M |
3300020528|Ga0208224_1012201 | Not Available | 1296 | Open in IMG/M |
3300020551|Ga0208360_1037679 | Not Available | 619 | Open in IMG/M |
3300020560|Ga0208852_1003893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3536 | Open in IMG/M |
3300020560|Ga0208852_1042275 | Not Available | 780 | Open in IMG/M |
3300020560|Ga0208852_1068574 | Not Available | 559 | Open in IMG/M |
3300021962|Ga0222713_10377517 | Not Available | 879 | Open in IMG/M |
3300021963|Ga0222712_10070024 | All Organisms → Viruses → Predicted Viral | 2539 | Open in IMG/M |
3300021963|Ga0222712_10148051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1587 | Open in IMG/M |
3300021963|Ga0222712_10193493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1338 | Open in IMG/M |
3300021963|Ga0222712_10199530 | Not Available | 1311 | Open in IMG/M |
3300021963|Ga0222712_10399565 | Not Available | 835 | Open in IMG/M |
3300021963|Ga0222712_10540233 | Not Available | 682 | Open in IMG/M |
3300022190|Ga0181354_1222908 | Not Available | 550 | Open in IMG/M |
3300022307|Ga0224507_10458412 | Not Available | 520 | Open in IMG/M |
3300022407|Ga0181351_1062426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1528 | Open in IMG/M |
3300022407|Ga0181351_1273101 | Not Available | 512 | Open in IMG/M |
3300023184|Ga0214919_10049332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4049 | Open in IMG/M |
3300024346|Ga0244775_10666701 | Not Available | 840 | Open in IMG/M |
3300024348|Ga0244776_10443592 | Not Available | 851 | Open in IMG/M |
3300025645|Ga0208643_1120935 | Not Available | 694 | Open in IMG/M |
3300026837|Ga0209856_1000708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1752 | Open in IMG/M |
3300027211|Ga0208307_1002852 | All Organisms → Viruses → Predicted Viral | 3017 | Open in IMG/M |
3300027212|Ga0208554_1038902 | Not Available | 760 | Open in IMG/M |
3300027214|Ga0208306_1032615 | Not Available | 944 | Open in IMG/M |
3300027468|Ga0209247_1004297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1839 | Open in IMG/M |
3300027468|Ga0209247_1014310 | Not Available | 1055 | Open in IMG/M |
3300027586|Ga0208966_1063170 | Not Available | 1044 | Open in IMG/M |
3300027608|Ga0208974_1000326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 20981 | Open in IMG/M |
3300027608|Ga0208974_1002064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7642 | Open in IMG/M |
3300027608|Ga0208974_1015766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2390 | Open in IMG/M |
3300027608|Ga0208974_1029118 | Not Available | 1673 | Open in IMG/M |
3300027608|Ga0208974_1103929 | Not Available | 756 | Open in IMG/M |
3300027608|Ga0208974_1109193 | Not Available | 731 | Open in IMG/M |
3300027608|Ga0208974_1172650 | Not Available | 536 | Open in IMG/M |
3300027621|Ga0208951_1061866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1071 | Open in IMG/M |
3300027621|Ga0208951_1127074 | Not Available | 678 | Open in IMG/M |
3300027627|Ga0208942_1002491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6433 | Open in IMG/M |
3300027659|Ga0208975_1007198 | Not Available | 3978 | Open in IMG/M |
3300027659|Ga0208975_1045494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1362 | Open in IMG/M |
3300027659|Ga0208975_1108813 | Not Available | 799 | Open in IMG/M |
3300027659|Ga0208975_1137418 | Not Available | 689 | Open in IMG/M |
3300027707|Ga0209443_1008262 | Not Available | 5205 | Open in IMG/M |
3300027707|Ga0209443_1145172 | Not Available | 867 | Open in IMG/M |
3300027732|Ga0209442_1107587 | Not Available | 1116 | Open in IMG/M |
3300027732|Ga0209442_1298482 | Not Available | 556 | Open in IMG/M |
3300027733|Ga0209297_1016914 | Not Available | 3501 | Open in IMG/M |
3300027734|Ga0209087_1022018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3121 | Open in IMG/M |
3300027736|Ga0209190_1015060 | Not Available | 4465 | Open in IMG/M |
3300027736|Ga0209190_1015657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4365 | Open in IMG/M |
3300027736|Ga0209190_1023039 | Not Available | 3454 | Open in IMG/M |
3300027736|Ga0209190_1036314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2600 | Open in IMG/M |
3300027746|Ga0209597_1000422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28052 | Open in IMG/M |
3300027754|Ga0209596_1005997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8860 | Open in IMG/M |
3300027754|Ga0209596_1028097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3227 | Open in IMG/M |
3300027754|Ga0209596_1035713 | All Organisms → Viruses → Predicted Viral | 2747 | Open in IMG/M |
3300027760|Ga0209598_10039392 | Not Available | 2526 | Open in IMG/M |
3300027763|Ga0209088_10067784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1693 | Open in IMG/M |
3300027764|Ga0209134_10254861 | Not Available | 601 | Open in IMG/M |
3300027770|Ga0209086_10337086 | Not Available | 629 | Open in IMG/M |
3300027770|Ga0209086_10344116 | Not Available | 619 | Open in IMG/M |
3300027782|Ga0209500_10021551 | Not Available | 3742 | Open in IMG/M |
3300027782|Ga0209500_10025044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3423 | Open in IMG/M |
3300027785|Ga0209246_10203444 | Not Available | 773 | Open in IMG/M |
3300027785|Ga0209246_10221516 | Not Available | 736 | Open in IMG/M |
3300027785|Ga0209246_10254825 | Not Available | 679 | Open in IMG/M |
3300027785|Ga0209246_10348009 | Not Available | 563 | Open in IMG/M |
3300027785|Ga0209246_10402442 | Not Available | 514 | Open in IMG/M |
3300027797|Ga0209107_10001630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12580 | Open in IMG/M |
3300027797|Ga0209107_10034011 | Not Available | 2917 | Open in IMG/M |
3300027797|Ga0209107_10076489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1834 | Open in IMG/M |
3300027798|Ga0209353_10279209 | Not Available | 712 | Open in IMG/M |
3300027808|Ga0209354_10070313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1418 | Open in IMG/M |
3300027836|Ga0209230_10120357 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Carboxylicivirga | 1476 | Open in IMG/M |
3300027836|Ga0209230_10136863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1388 | Open in IMG/M |
3300028394|Ga0304730_1225850 | Not Available | 690 | Open in IMG/M |
3300031539|Ga0307380_10217475 | Not Available | 1831 | Open in IMG/M |
3300031578|Ga0307376_10526431 | Not Available | 761 | Open in IMG/M |
3300031669|Ga0307375_10618874 | Not Available | 635 | Open in IMG/M |
3300031707|Ga0315291_10217708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1933 | Open in IMG/M |
3300031707|Ga0315291_10576914 | Not Available | 1025 | Open in IMG/M |
3300031707|Ga0315291_10813834 | Not Available | 811 | Open in IMG/M |
3300031707|Ga0315291_10934766 | Not Available | 737 | Open in IMG/M |
3300031707|Ga0315291_11556037 | Not Available | 517 | Open in IMG/M |
3300031746|Ga0315293_10518381 | Not Available | 917 | Open in IMG/M |
3300031746|Ga0315293_10820787 | Not Available | 679 | Open in IMG/M |
3300031772|Ga0315288_10804482 | Not Available | 867 | Open in IMG/M |
3300031772|Ga0315288_10970365 | Not Available | 760 | Open in IMG/M |
3300031834|Ga0315290_10510403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1049 | Open in IMG/M |
3300031857|Ga0315909_10073084 | Not Available | 3058 | Open in IMG/M |
3300031857|Ga0315909_10089351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2691 | Open in IMG/M |
3300031857|Ga0315909_10266423 | Not Available | 1303 | Open in IMG/M |
3300031857|Ga0315909_10406004 | Not Available | 974 | Open in IMG/M |
3300031857|Ga0315909_10815781 | Not Available | 587 | Open in IMG/M |
3300031885|Ga0315285_10297360 | Not Available | 1212 | Open in IMG/M |
3300031885|Ga0315285_10632708 | Not Available | 702 | Open in IMG/M |
3300031885|Ga0315285_10952172 | Not Available | 519 | Open in IMG/M |
3300031952|Ga0315294_10461276 | Not Available | 1172 | Open in IMG/M |
3300031952|Ga0315294_10845433 | Not Available | 782 | Open in IMG/M |
3300031999|Ga0315274_11552885 | Not Available | 625 | Open in IMG/M |
3300032046|Ga0315289_11427544 | Not Available | 534 | Open in IMG/M |
3300032053|Ga0315284_12447414 | Not Available | 510 | Open in IMG/M |
3300032118|Ga0315277_10578426 | All Organisms → Viruses → Predicted Viral | 1107 | Open in IMG/M |
3300032118|Ga0315277_11056744 | Not Available | 735 | Open in IMG/M |
3300032118|Ga0315277_11206595 | Not Available | 671 | Open in IMG/M |
3300032173|Ga0315268_11463529 | Not Available | 694 | Open in IMG/M |
3300032173|Ga0315268_11493318 | Not Available | 687 | Open in IMG/M |
3300032342|Ga0315286_11658500 | Not Available | 606 | Open in IMG/M |
3300032401|Ga0315275_10328537 | All Organisms → Viruses → Predicted Viral | 1712 | Open in IMG/M |
3300032516|Ga0315273_10413594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1816 | Open in IMG/M |
3300033992|Ga0334992_0070284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1931 | Open in IMG/M |
3300033992|Ga0334992_0342229 | Not Available | 688 | Open in IMG/M |
3300033995|Ga0335003_0129094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1278 | Open in IMG/M |
3300033996|Ga0334979_0000520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29371 | Open in IMG/M |
3300034063|Ga0335000_0080709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2256 | Open in IMG/M |
3300034063|Ga0335000_0443604 | Not Available | 761 | Open in IMG/M |
3300034082|Ga0335020_0420152 | Not Available | 642 | Open in IMG/M |
3300034093|Ga0335012_0116611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1480 | Open in IMG/M |
3300034103|Ga0335030_0011399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6812 | Open in IMG/M |
3300034103|Ga0335030_0016639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5621 | Open in IMG/M |
3300034103|Ga0335030_0312339 | Not Available | 1048 | Open in IMG/M |
3300034104|Ga0335031_0091255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2156 | Open in IMG/M |
3300034121|Ga0335058_0406420 | Not Available | 781 | Open in IMG/M |
3300034167|Ga0335017_0298403 | Not Available | 899 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.96% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 14.51% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 11.37% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 10.20% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.27% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.71% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.31% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.14% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.75% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.75% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.96% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.96% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.96% |
Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 1.96% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.57% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.18% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.18% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.18% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.78% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.39% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.39% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.39% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.39% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.39% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.39% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.39% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.39% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.39% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.39% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.39% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2149837002 | Marine microbial communities from the Baltic Sea | Environmental | Open in IMG/M |
3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
3300000126 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 26_20.5m | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
3300002302 | Freshwater microbial communities from Lake Mendota, WI - 05MAR2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002397 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300010340 | AD_USOAca | Engineered | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017699 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020510 | Freshwater microbial communities from Lake Mendota, WI - 06JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020525 | Freshwater microbial communities from Lake Mendota, WI - 05MAR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020528 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022307 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_13 | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300026837 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027211 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027214 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Baltic_Sea_00673310 | 2149837002 | Marine | MKKLIKYFTPVGAEEKAFAIAMLIVSTVTLSILFLFTFLELIL |
BS_KBA_SWE12_21mDRAFT_1000385611 | 3300000124 | Marine | MKRLINYFTPVGAEQKACAIAMLIVTSVTLSILFLFTFLELIL* |
BS_KBA_SWE12_21mDRAFT_1000413710 | 3300000124 | Marine | MKKLIKYFTPVGAEEKAFAIAMLIVSTVTLSILFLFTFLELIL* |
BS_KBA_SWE12_21mDRAFT_100044089 | 3300000124 | Marine | MKKLIKYFTPVGAEQIAFAVAMLTVTTVILSILFLFTFLELIL* |
BS_KBA_SWE12_21mDRAFT_100542693 | 3300000124 | Marine | MKKLIKYFTPVGAEQIAFAMAMLTVTTVILSILFLFTFLELVL* |
BS_KBB_SWE26_205mDRAFT_10031945 | 3300000126 | Marine | MKRLIKYFTPVGAEQKACAIAMLIVTSVTLSILFLFTFLELIL* |
JGI12421J11937_100116075 | 3300000756 | Freshwater And Sediment | MKKLINYFTPVGEEQIAFAKALMVVFTAIISILFLFTFLELIS* |
JGI12421J11937_100187468 | 3300000756 | Freshwater And Sediment | MKRLIKYLTPVGAEQIAFAKALMVVVTAIISIVFLFPLLTLLS* |
BS_KBA_SWE02_21mDRAFT_101860282 | 3300000792 | Marine | MKKLIKYFTPVGDEQIAIAKAFLIVTSVTLSILFLFTFLELIL* |
JGI24219J26650_10199243 | 3300002098 | Lentic | MKKLIKYFTPVGAEQIAFAVAMLTVTIVILSILFLFTFLELVL* |
B570J29635_10010525 | 3300002302 | Freshwater | MKKIINYFTPVGEEQKAFAKALMLVVTAMISIVFLFPLLNLLS* |
B570J29612_100135610 | 3300002397 | Freshwater | MKRLIKYFTPVGEEQIAFAKALMVVVTAVISIVFLFPLLSFIS* |
B570J29612_10029095 | 3300002397 | Freshwater | MKRLINYFTPVGAEQIAFAKALMVVVTAIISILFLFPLLTLLS* |
B570J40625_1011466762 | 3300002835 | Freshwater | MKKLINYFTPVGAEQIAFAKALIVVVTAIISIVFLFPLLTLLS* |
JGI25908J49247_100357015 | 3300003277 | Freshwater Lake | MKKLIKYFTPVGVEQIAFAMAMLTVTTVILSILFLFTFLELIL* |
JGI25908J49247_100755112 | 3300003277 | Freshwater Lake | MKKLINYFTPVGAEEKAFAIAMLIVTTVTLSILFLFTFLELIL* |
JGI25908J49247_100994443 | 3300003277 | Freshwater Lake | MKKLINYFTPVGEEQKACAIAMLIVTTVILSILFLFTFLEFIL* |
JGI25908J49247_101126591 | 3300003277 | Freshwater Lake | MKRLINYFTPVGVEQKDFAKALIVVVTAIISIVFLFPLLNLLS* |
JGI25910J50241_100005127 | 3300003388 | Freshwater Lake | MKRLIKYFTPVGEEQIAFAKALMVVVTAIISILFLFPLLNLLS* |
JGI25909J50240_10476913 | 3300003393 | Freshwater Lake | MKRLINYFTPVGXEQKDFAKALIVVVTAIISIVFLFPLLTLLS* |
JGI25909J50240_10559362 | 3300003393 | Freshwater Lake | MKRLINYFTPVGAEEKAFAIAMLIVTTVTLSILFLFTFLELIL* |
JGI25907J50239_10321692 | 3300003394 | Freshwater Lake | MKRLIKYFTPVGVEEIAFAKALMVVVTAVISIVFLFPLLNLLS* |
JGI25907J50239_10959682 | 3300003394 | Freshwater Lake | MKKLINYFTPVGAEEKAFAIAMLIVTTVILSILFLFTFLEFIL* |
JGI25920J50251_100448131 | 3300003404 | Freshwater Lake | MKRLINYFTPVGEEQIAIAKAFLIVTSVTLSILFLFTXLELIL* |
JGI25925J51416_101295752 | 3300003497 | Freshwater Lake | MKKLINYFTPVGAEEKAFAIAMLIVTTVILSILFLFTFLELIL* |
Ga0066177_104749791 | 3300004096 | Freshwater Lake | MKKLIDYFTPVGAEQIAFAKALMVVVTAVISIVFLFPLLNLLS* |
Ga0007761_107455062 | 3300004792 | Freshwater Lake | MKKLINYFTPVGEEQIAFAKALMVVVTAIISILFPLLNLLL* |
Ga0007759_114697243 | 3300004836 | Freshwater Lake | LINYFTPVGAEEKAFAIAMLIVTTVTLSILFLFTFLELIL* |
Ga0049083_100294827 | 3300005580 | Freshwater Lentic | ESMKRLINYFTPVGAEEKAFAITMLIVTTVTLSILFLFTFLELIL* |
Ga0049083_100657083 | 3300005580 | Freshwater Lentic | MKRLINYFTPVGEEQIAFAIAMLIVTTVILSILFLFTFLELIL* |
Ga0049083_100948632 | 3300005580 | Freshwater Lentic | MKKLINYFTPVGAEEKAFAIAMLIVTTVTLSILFLFTFLEFIL* |
Ga0049081_100352909 | 3300005581 | Freshwater Lentic | MKKLINYFTPVGAEQIAFAKALMVVVTAVILIVFLFPLLNLLS* |
Ga0049081_100651382 | 3300005581 | Freshwater Lentic | MKKLINYFTPVGAEQIAFAKTLMVVVTAVISILFLFPLLNLLS* |
Ga0049081_101441193 | 3300005581 | Freshwater Lentic | MKKLINYFTPVGEEQIAIAKAFIIVTSVTLSILFLFTFLEFIL* |
Ga0049081_101592614 | 3300005581 | Freshwater Lentic | MKKLINYFTPVGAEEIAIAKAFVIVVSATLSILFLFTFLELIS* |
Ga0049081_102911832 | 3300005581 | Freshwater Lentic | MKRLINYFTPVGEEQIAFAKALIVVVTAIISIVFLFPLLNLLS* |
Ga0049085_102306851 | 3300005583 | Freshwater Lentic | TPVGEEQIAFAKALIVVVTAVISILFLFTFLELIL* |
Ga0049082_100545282 | 3300005584 | Freshwater Lentic | MKRLINYFTPVGVEEIAFAKTLIVVVTAVISIVFLFPLLTLLS* |
Ga0049082_100707762 | 3300005584 | Freshwater Lentic | MKRLINYFTPVGVEQKDFAKALIVVVTAIISIVFLFPLLTLLS* |
Ga0049082_100862445 | 3300005584 | Freshwater Lentic | MKRLINYFTPVGEEQIAFAKAMLIVTTVTLSILFLFTFLELIL* |
Ga0049084_101731432 | 3300005585 | Freshwater Lentic | MKRLIKYFTPVGAEEKAFAITMLIVTTVTLSILFLFTFLELIL* |
Ga0049084_103071652 | 3300005585 | Freshwater Lentic | MKRLIKYFTPVGEEQIAFAKALMVVVTAVISILFLFPLLTLLS* |
Ga0079957_10249896 | 3300005805 | Lake | MKRLINYFTPVGAEQKACAIAMLIVTTVILSILFLFTFLELIL* |
Ga0073913_100022537 | 3300005940 | Sand | MKRLIKYFTPVGVEEIAFAKTLIVVVTAIISIVFLFPLLSFIS* |
Ga0073913_100027433 | 3300005940 | Sand | MKRLIKYFTPVGAEEKAFAIAMLIVTTVTLSILFLFTFLELIL* |
Ga0073913_100116372 | 3300005940 | Sand | MKRLIKYFTPVGVEEKAFAKTLIVVVTAIISIVFLFPLLSFIL* |
Ga0070744_100051928 | 3300006484 | Estuarine | MKKLINYFTPVGEEQKACAIAMLIVTTVILSILFLFTFLELIL* |
Ga0070744_101435031 | 3300006484 | Estuarine | MKRLINYFTPVGAEEKAFAIAMLIVTTVILSILFLFTFLELIL* |
Ga0075464_104770741 | 3300006805 | Aqueous | MKRLINYFTPVGEEQIAFAKAFVIVVSVTLSILFLFTFLELIL* |
Ga0075464_106367541 | 3300006805 | Aqueous | LINYFTPVGAEEKAFAIAMLIVTTVILSILFLFTFLELIL* |
Ga0075464_109536242 | 3300006805 | Aqueous | MKKLINYFTPVGAEEIAIAKAFVIVVSATLSILFLFTFLEFIS* |
Ga0070748_12896522 | 3300006920 | Aqueous | MKRLINYFTPVGAEEKAFAKALMVVVTAIISILFLFTFLELIL* |
Ga0099847_10439112 | 3300007540 | Aqueous | MKKLINYFTPVGAEQIAFAKALMVVVTAIISILFLFPLLNLLS* |
Ga0099847_12291522 | 3300007540 | Aqueous | MKKLINYFTPVGAEQIAFAKALILVVTAIISILFLFTFLELIL* |
Ga0102856_10311761 | 3300007636 | Estuarine | MKKLINYFTPVGAEQIAFAKAFVIVVSATLSILFLFPLLNLLS* |
Ga0104988_1084249 | 3300007735 | Freshwater | MKRLINYFTPVGAEQKAFAIAMFIVTSVTLSILFLFTFLELIL* |
Ga0105746_13587461 | 3300007973 | Estuary Water | MKKLINYFTPVGDEQIAIAKAFVIVVSATLSILFLFTFLEFIL* |
Ga0108970_113615405 | 3300008055 | Estuary | MKRLINYFTPVGAEEIAIAKAFVIVVSATLSILFLFTFLELIS* |
Ga0114359_10194722 | 3300008122 | Freshwater, Plankton | MKKIINYFTPVGAEQIAFAIAMLIVTTVILSILFLFTFLELIL* |
Ga0114841_12008582 | 3300008259 | Freshwater, Plankton | MKRLINYFTPVGEEQIAIAKALMVVVTAIISILFLFPLLNLLS* |
Ga0114841_12286654 | 3300008259 | Freshwater, Plankton | MKKLINYFTPVGEEQIAFAKALMVVVTAVISIVFLFPLLSFIS* |
Ga0114880_11168476 | 3300008450 | Freshwater Lake | RLINYFTPVGAEQKACAIAMLIVTSVTLSILFLFTFLELVL* |
Ga0114880_11573301 | 3300008450 | Freshwater Lake | RLINYFTPVGAEQKACAIAMLIVTSVTLSILFLFTFLELIL* |
Ga0114880_11640012 | 3300008450 | Freshwater Lake | MKRLIKYFTPVGAEQIAFAKAFLIVTSVTLSILFLFTFLELIL* |
Ga0114880_12698742 | 3300008450 | Freshwater Lake | MKKLINYFTPVGEEQIAFAKALMVVVTAVISIVFLFPLLSFIL* |
Ga0114880_12757173 | 3300008450 | Freshwater Lake | MKKLINYFTPVGAEQIAFAKALMIVVTAVISIVFLFPLLSFIS* |
Ga0102816_10833714 | 3300008999 | Estuarine | MKKIINYFTPVGEEQKACAIAMLIVTTVILSILFLFTFLELIL* |
Ga0102829_10644002 | 3300009026 | Estuarine | MKKLINYFTPVGAEEKAFAITMLIVTTVTLSILFLFTFLELIL* |
Ga0102829_13030093 | 3300009026 | Estuarine | FTPVGEEQKAFAIAMLIVTTVILSILFLFTFLELIL* |
Ga0114973_101257964 | 3300009068 | Freshwater Lake | MKKLINYFTPVGAEEIAIAKAFIIVTTVTLSILFLFTFLELIL* |
Ga0114973_104707191 | 3300009068 | Freshwater Lake | TPVGEEQIAIAKAFIIVTSVTLSILFLFTFLEFIL* |
Ga0114918_105795723 | 3300009149 | Deep Subsurface | MKKLIKYFTPVGAEQKAFAIAMLIVTSVTLSILFLFTFLELIL* |
Ga0114968_100148029 | 3300009155 | Freshwater Lake | MKKLINYFTPVGAEEIAIAKAFVIVTSVTLSILFLFTFLELIL* |
Ga0114977_100522907 | 3300009158 | Freshwater Lake | MKRLIKYFTPVGEEQIAFAKALMVVVTAVISIVFLFPLLTLLS* |
Ga0114977_101755513 | 3300009158 | Freshwater Lake | MKKLIKYFTPVGEEQIAIAKAFIIVTSVTLSILFLFTFLEFIL* |
Ga0114977_102473765 | 3300009158 | Freshwater Lake | MKKLINYFTPVGEEQIAFAKAFVIVVSATLSILFLFTFLELIL* |
Ga0114978_101613972 | 3300009159 | Freshwater Lake | MKKLINYFTPVGAEQIAIAKAFVIVVSATLSILFLFTFLEFIL* |
Ga0114978_104538462 | 3300009159 | Freshwater Lake | MKKLIKYFTPVGPEEIAIAKAFVIVTSVTLSILFLFTFLELIS* |
Ga0114966_104055662 | 3300009161 | Freshwater Lake | MKKLINYFTPVGVEQKDFAKALIVVVTAVISIVFLFPLLNLLS* |
Ga0114966_108062101 | 3300009161 | Freshwater Lake | MKKLINYFTPVGAEQIAFAKALMVVVTAVISIVFLFPLLTLLS* |
Ga0114970_100462102 | 3300009163 | Freshwater Lake | MKKLINYFTPVGEEQIACAKAFIIVTSVILSILFLFTFLEFIL* |
Ga0114970_100597763 | 3300009163 | Freshwater Lake | MKRLINYFTPVGAEQIAFAKALMVVVTAVISIVFLFPLLNLLS* |
Ga0114970_100744103 | 3300009163 | Freshwater Lake | MKRLINYFTPVGAEQIAFAKALMVVVTAIISILFLFTFLELIL* |
Ga0114970_102855752 | 3300009163 | Freshwater Lake | MKRLIKYLTPVGAEEKAFAIAMLIVTTVTLSILFLFTFLELIL* |
Ga0114979_102090701 | 3300009180 | Freshwater Lake | MKKLINYFTPVGAEEKAFAIAMLIVTTVTLSILFLFTFL |
Ga0114969_100665242 | 3300009181 | Freshwater Lake | MKRLINYFTPVGEEQIAFAKALMVVVTAVISIVFLFPLLSFIS* |
Ga0114971_105285564 | 3300009185 | Freshwater Lake | MKKLINYFTPVGDEQIAIAKAFLIVTSVTLSILFLFTFLELIS* |
Ga0114972_102903603 | 3300009187 | Freshwater Lake | MKRLIKYFTPVGEEQIAIAKAFIIVTSVTLSILFLFTFLELIL* |
Ga0116250_102315422 | 3300010340 | Anaerobic Digestor Sludge | MKKIINYFTPVGAEEKAFAIAMLIVTTVILSILFLFTFLELIL* |
Ga0133913_120048271 | 3300010885 | Freshwater Lake | IKYFTPVGEEQIAIAKAFIIVTSVTLSILFLFTFLEFIL* |
Ga0133913_127101875 | 3300010885 | Freshwater Lake | MKRLINYFTPVGEEQIAFAKALMVVVTAVISIVFLFPLLNLLS* |
Ga0139557_10624642 | 3300011010 | Freshwater | MKKLINYFTPVGEEQIAFAKALMVVVTAVISILFLFTFLELIL* |
Ga0153698_102679 | 3300011335 | Freshwater | MKRLINYFTPVGAEEKAFAIAMLIVTSVTLSILFLFTFLELIL* |
Ga0164293_101450662 | 3300013004 | Freshwater | MKKLINYFTPVGAEQIAIAKAFVIVISATLSILFLFTFLEFIL* |
Ga0177922_102417042 | 3300013372 | Freshwater | MKKLINYFTPVGEEQIAFAKAFIIVTSVILSILFLFTFLELIL* |
Ga0177922_104189762 | 3300013372 | Freshwater | MKRLIKYFTPVGEEQIAIAKAFIIVTSVTLSILFLFTFLEFIL* |
Ga0177922_111348832 | 3300013372 | Freshwater | MKKLINYFTPVGAEEKAFAKALMVVVTAVISILFLFTFLELIS* |
Ga0181338_10590362 | 3300015050 | Freshwater Lake | MKRLINYFTPVGEEQIAFAKALIVVVTAVISIVFLFPLLNLLS* |
Ga0181345_1019774 | 3300017699 | Freshwater Lake | KKLINYFTPVGDEQIAIAKAFVIVVSATLSILFLFTFLELIL |
Ga0181364_10088383 | 3300017701 | Freshwater Lake | MKKLINYFTPVGAEQIAIAKAFLIVTSVTLSILFLFTFLEFIS |
Ga0181364_10565341 | 3300017701 | Freshwater Lake | LINYFTPVGEEQIAFAKAFVIVVSATLSILFLFTFLELIL |
Ga0181347_11614162 | 3300017722 | Freshwater Lake | MKRLIKYFTPVGVEEIAFAKTLIVVVTAVISIVFLFPLLSFIL |
Ga0181362_10864862 | 3300017723 | Freshwater Lake | MKKLINYFTPVGPEEIAIAKAFVIVVSATLSILFLFTFLEFIL |
Ga0181365_11085862 | 3300017736 | Freshwater Lake | MKKLIKYFTPVGAEQIAFAKALMVVVTAVISILFLFTFLELIS |
Ga0181344_10748835 | 3300017754 | Freshwater Lake | MKRLINYFTPVGAEQIAFAKALMVVVTAVISIVFLFPLLSFIS |
Ga0181343_11348152 | 3300017766 | Freshwater Lake | MKKLLNYFTPVGAEEIAIAKAFVIVVSATLSILFLFTFLELIS |
Ga0181343_11998801 | 3300017766 | Freshwater Lake | ESMKRLIKYLTPVGEEQIAFAKALMVVVTAVISIVFLFPLLNLLS |
Ga0181358_12199023 | 3300017774 | Freshwater Lake | MKKLIDYFTPVGAEQIAIAKAFVIVVSATLSILFLFPLLNLLS |
Ga0181358_12547491 | 3300017774 | Freshwater Lake | MKRLINYFTPVGVEQKDFAKALIVVVTAIISIVFLFPL |
Ga0181349_12096081 | 3300017778 | Freshwater Lake | MKKLINYFTPVGAEEKAFAIAMLIVTTVTLSILFLFTF |
Ga0181346_13058462 | 3300017780 | Freshwater Lake | MKRIINYFTPVGAEQIAFAKALMVVVTAIISILFLFPLLNLLS |
Ga0181348_12173431 | 3300017784 | Freshwater Lake | MKKLINYFTPVGAEEKAFAIAMLIVTTVILSILFLFPLLNLLS |
Ga0181355_10589742 | 3300017785 | Freshwater Lake | MKRLIKYFTPVGEEQIAFAKAFIIVTSVILSILFLFTFLELIL |
Ga0181359_10256245 | 3300019784 | Freshwater Lake | MKKLINYFTPVGAEQIAIAKAFLIVTSVTLSILFLFTS |
Ga0181359_10568543 | 3300019784 | Freshwater Lake | MKKLIDYFTPVGAEQIAFAKALMVVVTAVISIVFLFPLLNLLS |
Ga0181359_10959303 | 3300019784 | Freshwater Lake | MKKLINYFTPVGEEQIAFAKAFVIVVSATLSILFLFTFLELIL |
Ga0181359_11615852 | 3300019784 | Freshwater Lake | MKRLINYFTPVGEEQIAIAKAFLIVTSVTLSILFLFTFLELIL |
Ga0181359_11832602 | 3300019784 | Freshwater Lake | MKKLINYFTPVGEEQIAFAKALMVVVTAIISILFLFPLLNLLL |
Ga0181359_11932801 | 3300019784 | Freshwater Lake | KNNTMKKLINYFTPVGAEQIAIAKAFLIVTSVTLSILFLFTFLEFIS |
Ga0181359_12105712 | 3300019784 | Freshwater Lake | MKRLINYFTPVGAEEKAFAIAMLIVTTVTLSILFLFTFLELIL |
Ga0181359_12536082 | 3300019784 | Freshwater Lake | MKRLINYFTPVGVEQKDFAKALIVVVTAIISIVFLFPLLNLLS |
Ga0181359_12725591 | 3300019784 | Freshwater Lake | MKKLINYFTPVGAEEKAFAIAMLIVTTVILSILFLFTFLELIL |
Ga0211732_14474271 | 3300020141 | Freshwater | MKKLINYFTPVGAEQKACAIAMLIVTSVTLSILFLFTFLELIL |
Ga0211736_102053043 | 3300020151 | Freshwater | MKKLIKYFTPVGAEEIAIAKAFVIVTFVTLSILFLFTFLKFIL |
Ga0211734_110675702 | 3300020159 | Freshwater | MKKLIKYFTPVGAEEIAIAKAFVIVTSVTLSILFLFTFLKFIL |
Ga0211733_111589643 | 3300020160 | Freshwater | MKKLIKYFTPVGAEEIAIAKAFIIVTSVTLSILFLFTFLELIL |
Ga0211726_100974791 | 3300020161 | Freshwater | MKKLIKYFTPVGAEQIAFAMAMLTVTTVILSILFLFTFLELIL |
Ga0211726_107646542 | 3300020161 | Freshwater | MKKLIKYFTPVGAEQIAFAVAMLTVTTVILSILFLFTFLELVL |
Ga0211731_107097713 | 3300020205 | Freshwater | MKKLINYFTPVGDEQIAIAKAFVIVTSVTLSILFLFTFLELIS |
Ga0211731_116136843 | 3300020205 | Freshwater | MKRLINYFTPVGDEQIAIAKAFLIVTSVTLSILFLFTFLELIL |
Ga0208086_10396972 | 3300020510 | Freshwater | MKKLINYFTPVGAEQIAFAKALIVVVTAIISILFLFTFLELIS |
Ga0207938_100012214 | 3300020525 | Freshwater | MKKIINYFTPVGEEQKAFAKALMLVVTAMISIVFLFPLLNLLS |
Ga0208224_10122012 | 3300020528 | Freshwater | MKKLINYFTPVGEEQIAFAKALMVVVTAIISILFLFPLLNLLS |
Ga0208360_10376792 | 3300020551 | Freshwater | MKRLINYFTPVGAEEKAFAIAMLIVTTVILSILFLFTFLELIL |
Ga0208852_10038933 | 3300020560 | Freshwater | MKRLIKYFTPVGEEQIAFAKALMVVVTAVISIVFLFPLLTLLS |
Ga0208852_10422753 | 3300020560 | Freshwater | MKRLIKYFTPVGEEQIAFAKALMVVVTAVISIVFLFPLLSFIS |
Ga0208852_10685742 | 3300020560 | Freshwater | MKKLINYFTPVGAEQIAFAKALIVVVTAIISIVFLFPLLTLLS |
Ga0222713_103775172 | 3300021962 | Estuarine Water | MKRLINYFTPVGAEEKAFAIAMLIVISVTLSILFLFTFLELIL |
Ga0222712_1007002410 | 3300021963 | Estuarine Water | MKRLIKYFTPVGAEEKAFAIAMLTVTTVTLSILFLFTFLELIL |
Ga0222712_101480511 | 3300021963 | Estuarine Water | MKKLIKYFTPVGEEQKACAIAMLIVTTVILSILFLFT |
Ga0222712_101934933 | 3300021963 | Estuarine Water | MKRLINYFTPVGEEQKACAIAMLIVTTVILSILFLFTFLELIL |
Ga0222712_101995303 | 3300021963 | Estuarine Water | MKRLIKYFTPVGVEEIAFAKTLIVVVTAVISILFLFPLLNLLS |
Ga0222712_103995651 | 3300021963 | Estuarine Water | MKRLIKYFTPVGAEEKAFAIAMLIVTTVILSILFLFTFLELIL |
Ga0222712_105402333 | 3300021963 | Estuarine Water | KYFTPIGAEEKAFAIAMLIVTTVTLSILFLFTFLELIL |
Ga0181354_12229082 | 3300022190 | Freshwater Lake | MKRLINYFTPVGEEQIAFAKAFVIVVSATLSILFLFTFLELIL |
Ga0224507_104584121 | 3300022307 | Sediment | MKKLINYFTPVGEEQKGFAKALIVVVTAVISIVFLFPFLTLLS |
Ga0181351_10624262 | 3300022407 | Freshwater Lake | MKRLIKYFTPVGEEQIAIAKAFIIVTSVTLSILFLFTFLELIL |
Ga0181351_12731012 | 3300022407 | Freshwater Lake | MKKLINYFTPVGPEEIAIAKAFVIVVSAIISILFLFPLLNLLS |
Ga0214919_100493324 | 3300023184 | Freshwater | MKKLINYFTPVGEEQIAFAKAFVIVVSATLSILFLFTFLEFIL |
Ga0244775_106667014 | 3300024346 | Estuarine | MKKLINYFTPVGAEEKAFAIAMLIVTTVTLSILFLFTFLELIL |
Ga0244776_104435922 | 3300024348 | Estuarine | MKRLIKYFTPVGEEQKAFAIAMLIVTTVTLSILFLFTFLELIL |
Ga0208643_11209352 | 3300025645 | Aqueous | MKKLINYFTPVGAEEIAIAKAFVIVVSATLSILFLFTFLEFIS |
Ga0209856_10007083 | 3300026837 | Sand | MKRLIKYFTPVGVEEIAFAKTLIVVVTAIISIVFLFPLLSFIS |
Ga0208307_100285212 | 3300027211 | Estuarine | FTPVGVEEKAFAKTLIVVVTAIISIVFLFPLLSFIL |
Ga0208554_10389022 | 3300027212 | Estuarine | MKRLIKYFTPVGAEEKAFAIAMLIVTTVTLSILFLFTFLELIL |
Ga0208306_10326153 | 3300027214 | Estuarine | MKRLIKYFTPVGVEEKAFAKTLIVVVTAIISIVFL |
Ga0209247_10042975 | 3300027468 | Freshwater Lake | MKRLIKYFTPVGEEQIAFAKALMVVVTAIISILFLFPLLNLLS |
Ga0209247_10143102 | 3300027468 | Freshwater Lake | MKKLINYFTPVGEEQKACAIAMLIVTTVILSILFLFTFLEFIL |
Ga0208966_10631702 | 3300027586 | Freshwater Lentic | MKRLINYFTPVGEEQIAFAKAMLIVTTVTLSILFLFTFLELIL |
Ga0208974_100032610 | 3300027608 | Freshwater Lentic | MKRLIKYLTPVGAEQIAFAKALMVVVTAVISIVFLFPLLNLLS |
Ga0208974_100206410 | 3300027608 | Freshwater Lentic | MKKLINYFTPVGAEQIAFAKALMVVVTAVILIVFLFPLLNLLS |
Ga0208974_10157667 | 3300027608 | Freshwater Lentic | MKKLINYFTPVGAEQIAFAKTLMVVVTAVISILFLFPLLNLLS |
Ga0208974_10291185 | 3300027608 | Freshwater Lentic | MKRLIKYFTPVGVEEIAFAKTLIVVVTAVISIVFLFPLLSFIS |
Ga0208974_11039291 | 3300027608 | Freshwater Lentic | MKRLINYFTPVGEEQIAFAKALMVVVTAVISIVFLFPL |
Ga0208974_11091932 | 3300027608 | Freshwater Lentic | MKKLINYFTPVGEEQIAIAKAFIIVTSVTLSILFLFTFLEFIL |
Ga0208974_11726501 | 3300027608 | Freshwater Lentic | MKRLINYFTPVGEEQIAFAKAFVIVVSATLSILFLFTFL |
Ga0208951_10618665 | 3300027621 | Freshwater Lentic | MKRLINYFTPVGAEEKAFAITMLIVTTVTLSILFLFTFLELIL |
Ga0208951_11270742 | 3300027621 | Freshwater Lentic | MKRLINYFTPVGEEQIAFAKALIVVVTAVISIVFLFPLLNLLS |
Ga0208942_10024916 | 3300027627 | Freshwater Lentic | MKKLIKYFTPVGEEQIAFAKALIVVVTAVISILFLFTFLELIL |
Ga0208975_10071985 | 3300027659 | Freshwater Lentic | MKKLINYFTPVGAEQIAFAKTLMVVVTAIISILFLFPLLNLLS |
Ga0208975_10454943 | 3300027659 | Freshwater Lentic | MKRLIKYFTPVGEEQIAIAKAFIIVTSVTLSILFLFTFLEFIS |
Ga0208975_11088135 | 3300027659 | Freshwater Lentic | KYFTPVGEEQIAFAKALMVVVTAVISIVFLFPLLSFIS |
Ga0208975_11374182 | 3300027659 | Freshwater Lentic | MKKLINYFTPVGAEQIAFAKALMVVVTAIISILFLFTFLELIS |
Ga0209443_10082628 | 3300027707 | Freshwater Lake | MKKLIKYFTPVGEEQIAFAKAFIIVTSVILSILFLFTFLELIL |
Ga0209443_11451722 | 3300027707 | Freshwater Lake | MKRLIKYFTPVGVEEIAFAKALMVVVTAVISIVFLFPLLNLLS |
Ga0209442_11075872 | 3300027732 | Freshwater Lake | MKRLINYFTPVGAEQIAFAKALMVVVTAIISILFLFPLLNLLS |
Ga0209442_12984822 | 3300027732 | Freshwater Lake | MKRLINYFTPVGAEEKAFAIAMLIVTTVTLSILFLFTFLEFIL |
Ga0209297_10169144 | 3300027733 | Freshwater Lake | MKKLIKYFTPVGEEQIAIAKAFIIVTSVTLSILFLFTFLEFIL |
Ga0209087_102201810 | 3300027734 | Freshwater Lake | MKKLINYFTPVGAEEIAIAKAFVIVVSATLSILFLFTFLELIS |
Ga0209190_10150608 | 3300027736 | Freshwater Lake | MKRLINYFTPVGAEQIAFAKALMVVVTAIISILFLFTFLELIL |
Ga0209190_10156574 | 3300027736 | Freshwater Lake | MKRLIKYLTPVGAEEKAFAIAMLIVTTVTLSILFLFTFLELIL |
Ga0209190_10230395 | 3300027736 | Freshwater Lake | MKRLINYFTPVGAEQIAFAKALMVVVTAVISIVFLFPLLNLLS |
Ga0209190_10363145 | 3300027736 | Freshwater Lake | MKKLINYFTPVGEEQIACAKAFIIVTSVILSILFLFTFLEFIL |
Ga0209597_100042234 | 3300027746 | Freshwater Lake | MKKLINYFTPVGAEEIAIAKAFIIVTTVTLSILFLFTFLELIL |
Ga0209596_10059977 | 3300027754 | Freshwater Lake | MKKLINYFTPVGAEEIAIAKAFVIVTSVTLSILFLFTFLELIL |
Ga0209596_10280973 | 3300027754 | Freshwater Lake | MKRLINYFTPVGEEQIAFAKALMVVVTAVISIVFLFPLLSFIS |
Ga0209596_10357139 | 3300027754 | Freshwater Lake | MKRLINYFTPVGAEEIAIAKAFVIVTSVTLSILFLFTFLELIL |
Ga0209598_100393926 | 3300027760 | Freshwater Lake | MKRLIKYFTPVGEEQIAIAKAFIIVTSVTLSILFLFTFLEFIL |
Ga0209088_100677846 | 3300027763 | Freshwater Lake | ESMKKLINYFTPVGAEEKAFAIAMLIVTTVTLSILFLFTFLELIL |
Ga0209134_102548611 | 3300027764 | Freshwater Lake | MKRLINYFTPVGAEQIAFAKALMVVVTAIISIVFL |
Ga0209086_103370863 | 3300027770 | Freshwater Lake | MKKLINYFTPVGAEQIAFAKALMVVVTAVISIVFLFPLLTLLS |
Ga0209086_103441162 | 3300027770 | Freshwater Lake | MKKLINYFTPVGVEQKDFAKALIVVVTAVISIVFLFPLLNLLS |
Ga0209500_100215519 | 3300027782 | Freshwater Lake | MKKLIKYFTPVGPEEIAIAKAFVIVTSVTLSILFLFTFLELIS |
Ga0209500_100250449 | 3300027782 | Freshwater Lake | MKKLIKYFTPVGAEEIAIAKAFVIVTSVTLSILFLFTFLELIL |
Ga0209246_102034443 | 3300027785 | Freshwater Lake | MKRLINYFTPVGEEQIAFAKALMVVVTAVISIVFLFPLLSFIL |
Ga0209246_102215164 | 3300027785 | Freshwater Lake | NTMKKLINYFTPVGAEQIAIAKAFVIVVSATLSILFLFTFLELIL |
Ga0209246_102548252 | 3300027785 | Freshwater Lake | MKKLINYFTPVGAEEKAFAIAMLIVTTVILSILFLFTFLEFIL |
Ga0209246_103480092 | 3300027785 | Freshwater Lake | MKRLINYFTPVGEEQIAFAIAMLIVTTVILSILFLFTFLELIL |
Ga0209246_104024422 | 3300027785 | Freshwater Lake | MKRLINYFTPVGAEEKAFAIAMLIVTSVTLSILFLFTFLELIL |
Ga0209107_1000163016 | 3300027797 | Freshwater And Sediment | MKRLIKYLTPVGAEQIAFAKALMVVVTAIISIVFLFPLLTLLS |
Ga0209107_100340116 | 3300027797 | Freshwater And Sediment | MKKLINYFTPVGAEQIAFAKALILVVTAIISILFLFTFLELIL |
Ga0209107_100764897 | 3300027797 | Freshwater And Sediment | MKKLINYFTPVGEEQIAFAKALMVVFTAIISILFLFTFLELIS |
Ga0209353_102792092 | 3300027798 | Freshwater Lake | MKRLINYFTPVGEEQIAFAKALIVVVTAVISILFLFPLLTLLS |
Ga0209354_100703135 | 3300027808 | Freshwater Lake | MKKLIKYFTPVGAEQIAIAKAFVIVTSVTLSILFLFTFLELIS |
Ga0209230_101203572 | 3300027836 | Freshwater And Sediment | MKKLIKYFTPVGEEQIAFAKAFIIVTSVTLSILFLFTFLELIL |
Ga0209230_101368631 | 3300027836 | Freshwater And Sediment | MKKLINYFTPVGEEQIAFAKALMVVVTAVISILFLFPLLTLLS |
Ga0304730_12258501 | 3300028394 | Freshwater Lake | MKKLIKYFTPVGAEEIAIAKAFVIVTSVTLSILFLFTFL |
Ga0307380_102174755 | 3300031539 | Soil | MKKLIKYFTPVGAEQIAFAMAMLTVTTVILSILFLFTFLELVL |
Ga0307376_105264312 | 3300031578 | Soil | MKKLIKYFTPVGTEEKAFAIAMLIVSTVTLSILFLFTFLELIL |
Ga0307375_106188741 | 3300031669 | Soil | MKKLIKYFTPVGAEQIAFAITMLTVTTVILSILFLFTFLELVL |
Ga0315291_102177082 | 3300031707 | Sediment | MKRLINYFTPVGAEQKAFAIAMLIVTTVTLSILFLFTFLELIL |
Ga0315291_105769142 | 3300031707 | Sediment | MKKLIKYFTPVGEEQIAIAKAFVIVVSATLSILFLFTFLELIL |
Ga0315291_108138343 | 3300031707 | Sediment | MKKLIKYFTPVGDEEIAIAKAFVIVTSVTLSILFLFTFLELIL |
Ga0315291_109347661 | 3300031707 | Sediment | MKRLINYFTPVGVEQKDFAKALIVVVTAIISIVFL |
Ga0315291_115560371 | 3300031707 | Sediment | NTMKRLIKYFTPVGEEQKACAIAMLIVTTVILSILFLFTFLELIL |
Ga0315293_105183812 | 3300031746 | Sediment | MKRIINYFTPVGEEQKAFAKTLIVVVTAVISIVFLFPLLSFIS |
Ga0315293_108207873 | 3300031746 | Sediment | MKRLIKYFTPVGAEEIAIAKAFVIVVSATLSILFLFTFLELIL |
Ga0315288_108044822 | 3300031772 | Sediment | MKRLIKYFTPVGEEQIAIAKAFVIVVSATLSILFLFTFLELIL |
Ga0315288_109703652 | 3300031772 | Sediment | MKRLINYFTPVGAEQKAFAIAMLIVTTVILSILFLFTFLELIL |
Ga0315290_105104035 | 3300031834 | Sediment | MKRLINYFTPVGEEQKAFAKTLIVVVTAVISIVFLFPLLSFIS |
Ga0315909_100730844 | 3300031857 | Freshwater | MKKIINYFTPVGAEQIAFAIAMLIVTTVILSILFLFTFLELIL |
Ga0315909_100893512 | 3300031857 | Freshwater | MKRLINYFTPVGAEQKACAIAMLIVTSVTLSILFLFTFLELVL |
Ga0315909_102664235 | 3300031857 | Freshwater | MKRLIKYFTPVGAEQIAFAKAFLIVTSVTLSILFLFTFLELIL |
Ga0315909_104060042 | 3300031857 | Freshwater | MKRLINYFTPVGAEQIAFAKALIVVVTAVISIVFLFPLLSFIS |
Ga0315909_108157812 | 3300031857 | Freshwater | MKRLINYFTPVGEEQIAIAKAFLIVTSVTLSILFLFTFLELIS |
Ga0315285_102973602 | 3300031885 | Sediment | MKKLIKYFTPVGAEEIAIAKAFIIVVSATLSILFLFTFLSCIL |
Ga0315285_106327082 | 3300031885 | Sediment | MKRLINYFTPVGEEQKAFAIAMLIVTTVTLSILFLFTFLELIL |
Ga0315285_109521722 | 3300031885 | Sediment | MKRLINYFTPVGAEQKAFAIAMLIVTTVILSILFLFTFLEL |
Ga0315294_104612763 | 3300031952 | Sediment | MKKLIKYFTPVGEEQKAFAIAMLIVTTVILSILFLFTFLELIL |
Ga0315294_108454332 | 3300031952 | Sediment | MKKLIKYFTPVGEEQKGFAMAMLIVTTVILSILFLFTFLELIL |
Ga0315274_115528852 | 3300031999 | Sediment | MKKLIKYFTPVGEEQIAIAKAFIIVTSVTLSILFLFTFLELIL |
Ga0315289_114275443 | 3300032046 | Sediment | YFTPVGEEQIAIAKAFIIVVSATLSILFLFTFLSCIL |
Ga0315284_124474142 | 3300032053 | Sediment | KNNTMKRLIKYFTPVGEEQIAIAKAFVIVVSATLSILFLFTFLELIL |
Ga0315277_105784265 | 3300032118 | Sediment | SMKKLIKYFTPVGEEQIAIAKAFIIVTSVTLSILFLFTFLELIL |
Ga0315277_110567442 | 3300032118 | Sediment | MKRLIKYFTPVGEEQKACAIAMLIVTTVILSILFLF |
Ga0315277_112065953 | 3300032118 | Sediment | NNTMKRLIKYFTPVGEEQIAIAKAFVIVVSATLSILFLFTFLELIL |
Ga0315268_114635292 | 3300032173 | Sediment | MKRLINYFTPVGVEQKDFAKALIVVVTAIISIVFLFPLLSFIS |
Ga0315268_114933183 | 3300032173 | Sediment | RLINYFTPVGAEQKAFAIAMLIVTTVILSILFLFTFLELIL |
Ga0315286_116585003 | 3300032342 | Sediment | MKKLIKYFTPVGAEEIAIAKAFIIVVSATLSILFLFTFLELIL |
Ga0315275_103285376 | 3300032401 | Sediment | MKKLIKYFTPVGVEQIAFAMAMLTVTTVVLLILFLFTFLELIL |
Ga0315273_104135945 | 3300032516 | Sediment | MKRIINYFTPVGAEQKAFAIAMLIVTTVTLSILFLFTFLELIL |
Ga0334992_0070284_261_392 | 3300033992 | Freshwater | MKKLINYFTPVGAEEKAFAIAMLIVTTVILSILFLFTFLELIS |
Ga0334992_0342229_561_686 | 3300033992 | Freshwater | MKKLIKYFTPVGVEQIAFAMAMLTVTTVILSILFLFTFLELI |
Ga0335003_0129094_307_438 | 3300033995 | Freshwater | MKKLINYFTPVGEEQIAFAKALMLVVTAIISILFLFPLLNLLS |
Ga0334979_0000520_27566_27697 | 3300033996 | Freshwater | MKKLINYFTPVGAEQIAIAKAFVIVISATLSILFLFTFLEFIL |
Ga0335000_0080709_1885_2016 | 3300034063 | Freshwater | MKRLINYFTPVGAEQKACAIAMLIVTTVILSILFLFTFLELIL |
Ga0335000_0443604_390_521 | 3300034063 | Freshwater | MKKIINYFTPVGEEQIAIAKAFLIVTSVTLSILFLFTFLELIS |
Ga0335020_0420152_111_239 | 3300034082 | Freshwater | MKKLIKYFTPVGEEQIAFAKALMVVVTAIISILFLFPLLNLL |
Ga0335012_0116611_1088_1219 | 3300034093 | Freshwater | MKKLIKYFTPVGAEQKACAKALMVVVTAIISILFLFTFLELIL |
Ga0335030_0011399_4033_4164 | 3300034103 | Freshwater | MKRLIKYFTPVGEEQIAFAKTLIVVVTAVISIVFLFPLLSFIS |
Ga0335030_0016639_4072_4203 | 3300034103 | Freshwater | MKRLIKYFTPVGVEEIAFAKTLIVVVTAIISIVFLFPLLTLLS |
Ga0335030_0312339_489_620 | 3300034103 | Freshwater | MKRLIKYFTPVGEEQIAIAKALMLVVTAIISILFLFPLLNLLS |
Ga0335031_0091255_240_371 | 3300034104 | Freshwater | MKRLIKYFTPVGEEQKACAIAMLIVTSVTLSILFLFTFLELIL |
Ga0335058_0406420_629_757 | 3300034121 | Freshwater | MKKLINYFTPVGDEQIAFAKALMVVVTAVISILFLFPLLILL |
Ga0335017_0298403_647_778 | 3300034167 | Freshwater | MKKLINYFTPVGAEQIAIAKAFVIVVSATLSILFLFTFLELIS |
⦗Top⦘ |