Basic Information | |
---|---|
Family ID | F017557 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 240 |
Average Sequence Length | 42 residues |
Representative Sequence | MKGQTHGGKGSAQRKTDQKKFASNWDAIYNKTAQKSSKKKK |
Number of Associated Samples | 172 |
Number of Associated Scaffolds | 240 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 64.85 % |
% of genes near scaffold ends (potentially truncated) | 41.25 % |
% of genes from short scaffolds (< 2000 bps) | 76.25 % |
Associated GOLD sequencing projects | 154 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (54.167 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (19.583 % of family members) |
Environment Ontology (ENVO) | Unclassified (67.500 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.250 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 240 Family Scaffolds |
---|---|---|
PF11753 | DUF3310 | 14.17 |
PF12236 | Head-tail_con | 5.83 |
PF11651 | P22_CoatProtein | 5.42 |
PF03237 | Terminase_6N | 2.50 |
PF02867 | Ribonuc_red_lgC | 1.25 |
PF05367 | Phage_endo_I | 0.83 |
PF13884 | Peptidase_S74 | 0.83 |
PF05065 | Phage_capsid | 0.83 |
PF08291 | Peptidase_M15_3 | 0.42 |
PF04689 | S1FA | 0.42 |
PF13662 | Toprim_4 | 0.42 |
PF13155 | Toprim_2 | 0.42 |
PF13392 | HNH_3 | 0.42 |
PF04313 | HSDR_N | 0.42 |
PF00476 | DNA_pol_A | 0.42 |
COG ID | Name | Functional Category | % Frequency in 240 Family Scaffolds |
---|---|---|---|
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 1.25 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.83 |
COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.42 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 54.17 % |
All Organisms | root | All Organisms | 45.83 % |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 19.58% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.83% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.17% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.67% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 6.67% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.42% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.00% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.00% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.33% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.92% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.92% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.08% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.08% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.67% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.67% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.67% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.25% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.25% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.25% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.25% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.83% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.83% |
Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.83% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.83% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.83% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.42% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.42% |
Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.42% |
Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.42% |
Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.42% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.42% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.42% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.42% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.42% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.42% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2236876002 | Marine microbial communities from Columbia River, CM, sample from CR-7km from mouth, GS312-0p8-CR7-chlmax | Environmental | Open in IMG/M |
2236876004 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-0p1-ETM-15m | Environmental | Open in IMG/M |
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300000224 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10m | Environmental | Open in IMG/M |
3300001278 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY75 | Host-Associated | Open in IMG/M |
3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
3300002153 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Metagenome | Environmental | Open in IMG/M |
3300002186 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Metagenome | Environmental | Open in IMG/M |
3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
3300003263 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_48_BLW_10 | Environmental | Open in IMG/M |
3300003271 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
3300005609 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 | Environmental | Open in IMG/M |
3300005821 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1 | Environmental | Open in IMG/M |
3300005828 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI | Environmental | Open in IMG/M |
3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
3300006382 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006424 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
3300007715 | Estuarine microbial communities from the Columbia River estuary - metaG S.751 | Environmental | Open in IMG/M |
3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
3300007981 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 | Environmental | Open in IMG/M |
3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
3300008517 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4 | Environmental | Open in IMG/M |
3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
3300009142 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
3300013231 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 5m_Station5_GOM_Metagenome | Environmental | Open in IMG/M |
3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018642 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p1 | Environmental | Open in IMG/M |
3300019098 | Metatranscriptome of marine microbial communities from Baltic Sea - GS684_0p1 | Environmental | Open in IMG/M |
3300019718 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_5-6_MG | Environmental | Open in IMG/M |
3300019750 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States - FLT_6-7_MG | Environmental | Open in IMG/M |
3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
3300023693 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 29R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023698 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
3300026443 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026466 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026500 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027315 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_03_M0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027771 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
3300028109 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
3300028135 | Seawater microbial communities from Monterey Bay, California, United States - 7D | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
3300031589 | Marine microbial communities from David Island wharf, Antarctic Ocean - #35 | Environmental | Open in IMG/M |
3300031660 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261 | Environmental | Open in IMG/M |
3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
3300032257 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrite | Environmental | Open in IMG/M |
3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
none_0875033 | 2236876002 | Marine Estuarine | MKGQTHGGKGSAQRSTDQKKFASNWDAIYNKTAQKSS |
none_03128731 | 2236876004 | Marine Estuarine | KGQTHGGKGSAQRSTDQKKFASNWDAIYNKTAQKSSKKKK |
DelMOSum2010_100329814 | 3300000101 | Marine | MKGQTHGGKGSAQRKTDQKKFAANWDAIYNKTTEKSSKKTNKA* |
DelMOSum2010_100628771 | 3300000101 | Marine | VKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAEKSSKKKK* |
DelMOSum2010_101351334 | 3300000101 | Marine | MKGQTHGGKGSAQRKTDXKKFAXNWDAIYNKTAQKSSKNKK* |
DelMOSum2010_101550223 | 3300000101 | Marine | MKGQTHGGKGSSQRKTDSAKFASNWDAIYNKQAQKSSKKKK* |
DelMOSum2010_101963341 | 3300000101 | Marine | MKGQTHGGKGSTQRKTDQKKFSANWDAIYNKSTQKSSKKTNKA* |
DelMOSum2011_100083089 | 3300000115 | Marine | MKGQTHGGKGSTQRKTDQKKFSANWDAIYNKSTQKSS |
DelMOSpr2010_101309063 | 3300000116 | Marine | VKGQTHGGKGSGQRKTDPKKFASNWDAIFKQPKKKTEKK* |
DelMOSpr2010_101443131 | 3300000116 | Marine | KGSAQRPTDGKKFASNWDAIFNKTQQKPKDKKKEVKK* |
DelMOSpr2010_101904662 | 3300000116 | Marine | GKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDNKKEVKK* |
DelMOSpr2010_102037433 | 3300000116 | Marine | MKGQTHGGKGSSQRKTDSKKFAANWDAIYNKTAQKSSKNKK* |
DelMOSpr2010_102688413 | 3300000116 | Marine | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDN |
DelMOWin2010_100088017 | 3300000117 | Marine | MKGQTHGGKGSAQRKTDSKKFAANWDAIYNKPAQKSSKNKK* |
DelMOWin2010_101156341 | 3300000117 | Marine | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDNKKE |
SI34jun09_10mDRAFT_100009431 | 3300000224 | Marine | VKGQTHGGKGSSQRKTDPKKFASNWDAIFKQPKKKTEKK* |
BBAY75_102637673 | 3300001278 | Macroalgal Surface | MKGQTHGGKGSAQRKTDSKKFAANWDAIYNKNTTKSSKKKK* |
JGI20154J14316_101258842 | 3300001348 | Pelagic Marine | MKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAQKSSKKKK* |
JGI20153J14318_101502062 | 3300001351 | Pelagic Marine | MKGQTHGGKGSSQRKTDSAKFASNWDAIYNKPAEKSSKKKK* |
JGI20157J14317_101686373 | 3300001352 | Pelagic Marine | AMKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAKKSSKKANKA* |
JGI20157J14317_102017821 | 3300001352 | Pelagic Marine | MKGQTHGGKGSAQRKTDQKKFAANWDAIYNKNTTKSSKKNK* |
JGI24540J26637_100128691 | 3300002153 | Marine | MKGQTHGGKGSSQRKTDAAKFSANWDAIYSKPSKKSSKT |
JGI24539J26755_100010253 | 3300002186 | Marine | MKGQTHGGKGSSQRKTDAAKFSANWDAIYSKPSKKSSKTKK* |
JGI25133J35611_100782071 | 3300002514 | Marine | VKGQTHGGKGSSQRKTDHKKFASNWDAIYNKTAQKSSKNKK* |
JGI26117J46588_10021344 | 3300003263 | Marine | MKGQTHGGKGSTQRKTDSKKFASNWDAIYNKPAEKSSKNKK* |
JGI26114J46594_10016906 | 3300003271 | Marine | MKGQTHGGKGSAQRKTDQKKFASNWDAIYSKSIQKSSKKTNKA* |
Ga0065861_10125052 | 3300004448 | Marine | MKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAKKSSKKANKA* |
Ga0065861_10125363 | 3300004448 | Marine | MKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAKKSSKKKK* |
Ga0066224_10022084 | 3300004457 | Marine | MKGQTHGGKGSAQRKTDQKKFAANWDAIYNKNTTKSSKKKK* |
Ga0066224_10059095 | 3300004457 | Marine | MKGQTHGGKGSSQRKTDAAKFSANWDAIYSKPTKKSSKTKK* |
Ga0073579_11846894 | 3300005239 | Marine | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDNKKELKK* |
Ga0070724_102537012 | 3300005609 | Marine Sediment | VKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAQKSSKKKK* |
Ga0070724_103380891 | 3300005609 | Marine Sediment | GQTHGGKGSSQRKTDQKKFASNWDAIYNKTAQKSSKNKK* |
Ga0078746_10948641 | 3300005821 | Marine Sediment | THGSKGSAQRKTDQKKFASNWDAIYNKSTQKSSKKTNKA* |
Ga0078746_11158651 | 3300005821 | Marine Sediment | MKGQTHGGKGSTQRKTDQKKFAANWDAIYNKNTTKSSKKKK* |
Ga0074475_107970181 | 3300005828 | Sediment (Intertidal) | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDNKKEVKK* |
Ga0078893_104737702 | 3300005837 | Marine Surface Water | MQGQTHGGKGSGQRPTKDSKKFASNWDAIFNKTQQKPKDKKKEVKK* |
Ga0070743_101087383 | 3300005941 | Estuarine | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDKKEEDKK* |
Ga0075478_100413094 | 3300006026 | Aqueous | MKGQTHGGKGSSQRKTDSKKFAANWDAIYNKPAQKSSKNKK* |
Ga0075478_102411601 | 3300006026 | Aqueous | MKGQTHGGKGSTQRKTDQKKFASNWDAIYNKPIQKSSKKTNKA* |
Ga0075462_100778612 | 3300006027 | Aqueous | VKGQTHGGKGSAQRKTDQKKFASNWDVIYNKTAQKSSKNKK* |
Ga0075441_101285932 | 3300006164 | Marine | MKGQTHGGKGSATRKADSAKFASNWDAIYNKPAQKSSKKKK* |
Ga0075441_101436635 | 3300006164 | Marine | MKGQTHGGKGSSTRKTDAAKFTSNWDAIYSKPAKKSSKDKK* |
Ga0075441_102309051 | 3300006164 | Marine | MKGQTHGGKGSSTRKTDTNKFASNWDAIYSKPTKKSSKDKK* |
Ga0075443_102334983 | 3300006165 | Marine | VKGQTHGGKGSTTRNTDAAKFSSNWDAIYSKPAKKSSKKKK* |
Ga0075446_100771291 | 3300006190 | Marine | VKGQTHGGKGSTQRKTDSKKFGSNWDSIYKTPKKKKTVKK* |
Ga0075446_101667222 | 3300006190 | Marine | VKGQTHGGKGSSQRKTDSAKFGANWDAIYNKSAQKSSKKKK* |
Ga0075448_101537182 | 3300006352 | Marine | MKGQTHGGKGSATRKTDSAKFASNWDAIYSKPAKKSSKKKK* |
Ga0075494_10371944 | 3300006382 | Aqueous | KGSAQRKTDQKKFAANWDAIYNKSTQKSSKKTNKA* |
Ga0075494_10498444 | 3300006382 | Aqueous | MKGQTHGGKGSTTRKTDSAKFASNWDAIYNKPAKKSSKKKK* |
Ga0075514_10596435 | 3300006403 | Aqueous | HGGKGSAQRKTDQKKFASNWDAIYNKTAQKSSKNKK* |
Ga0075497_10588242 | 3300006424 | Aqueous | MKGQTHGGKGSTQRKTDQKKFSVNWEAIYNKSTQKSSKKTNKA* |
Ga0099972_102731623 | 3300006467 | Marine | GQTHGGKGSSQRKTDSKKFAANWDAIYNKTTKKSSKNTNKA* |
Ga0098037_12831782 | 3300006737 | Marine | MKGQTHGGKGSAQRSTDQKKFASNWDAIYNKTEQKSSKKKK* |
Ga0098048_10265563 | 3300006752 | Marine | MQGQTHGGKGSGQRPTKDSKKFASNWDAIFNKTQQKPKDKKEEDRK* |
Ga0098048_10913411 | 3300006752 | Marine | MKGQTHGGKGSAQRKTDQKKFAANWDAIYNKTEQKSSKKKK* |
Ga0070749_102651404 | 3300006802 | Aqueous | MKGQTHGGKGSSQRKTDQKKFASNWDAIYNKTAQKSSK |
Ga0070749_103362954 | 3300006802 | Aqueous | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDKKKELKK* |
Ga0070749_104782293 | 3300006802 | Aqueous | KGSSQRKTDSKKFAANWDAIYNKTTKKSSKNTNKA* |
Ga0075467_102482111 | 3300006803 | Aqueous | EKEASEEMKGQTHGGKGSTTRKTDSAKFASNWDAIYNKPAKKSSKKKK* |
Ga0075467_103278621 | 3300006803 | Aqueous | MKGQTHGGKGSTQRKTDQKKFAANWDAIYNKNTTKSSKKTNKA* |
Ga0070754_100296755 | 3300006810 | Aqueous | MKGQTHGGKGSTQRKTDQKKFAANWGAIYNKNTTKSSKKTNNA* |
Ga0070754_101706314 | 3300006810 | Aqueous | MKGQTHGSKGSAQRKTDQKKFAANWDAIYNKNTTKSSKKKK* |
Ga0070754_102637071 | 3300006810 | Aqueous | HGGKGSGQRPTKDSKKFASNWDAIFNKTQQKPKDKKKEVKK* |
Ga0070754_104408822 | 3300006810 | Aqueous | MKGQTHGGKGSSQRKTDHKKFTSNWDAIYNKTAQKSSKNKK* |
Ga0075476_101550323 | 3300006867 | Aqueous | VKGQTHGGKGSAQRKTDQKKFASNWDAIYNKTAQKSSKNKK* |
Ga0070750_102467381 | 3300006916 | Aqueous | AQRPAEDSKKFASNWDAIFNKTQQKPKDKKKELKK* |
Ga0070748_12069403 | 3300006920 | Aqueous | MKGQTHGGKGSAQRKTDQKKFASNWDAIYNKTAQKSSKKKK* |
Ga0098051_10064766 | 3300006924 | Marine | VKGQTHGGKGSTQRKTDQKKFASNWDAIYNKTAQKSSKNKK* |
Ga0098036_11251905 | 3300006929 | Marine | MKGQTHGGKGSTQRKTDQKKFASNWDAIYNKTAQKS |
Ga0075468_101247475 | 3300007229 | Aqueous | MKGQTHGGKGSAQRKTDQKKFASNWDAIYNKTAQKSSKKKK |
Ga0075468_101977391 | 3300007229 | Aqueous | MKGQTHGGKGSSQRKTDQKKFASNWDAIYNKPIQKSSKQTNK |
Ga0075468_102381362 | 3300007229 | Aqueous | MKGQTHGGKGSAQRKTDQKKFASNWDAIYNKTEQKSSKKKK* |
Ga0075469_101673002 | 3300007231 | Aqueous | MKGQTHGGKGSTQRKTDQKKFAANWDAIYNKNTTKSSK |
Ga0075460_102067013 | 3300007234 | Aqueous | MKGQTHGGKGSAQRSTDQKKFASNWDAIYNKTAQKSSK |
Ga0070747_10491235 | 3300007276 | Aqueous | MKGQTHGGKGSSQRKTDHKKFASNWDAIYNKPAKKSSKKKK* |
Ga0070747_13073991 | 3300007276 | Aqueous | MKGQTHGGKGSAQRPAEDAKKFASNWDAIFNKTQQKPKDKKKE |
Ga0070745_10781162 | 3300007344 | Aqueous | MKGQTHGGKGSTQRKTDQKKFAANWGAIYNKNTTKSSKKKK* |
Ga0070752_12978312 | 3300007345 | Aqueous | VKGQTHGGKGSTQRKTDQKKFASNWDAIYNKTAQKSSKN |
Ga0102879_11500772 | 3300007549 | Estuarine | MKHGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDNKKEVKK* |
Ga0102881_10128456 | 3300007551 | Estuarine | MKGQTHGGKGSSQRPAEDSKKFSSNWDAIFNKTQQKPKDNKKELKK* |
Ga0102898_11766231 | 3300007658 | Estuarine | MKGQTHGGKGSSQRPAEDSKKFSSNWDAIFNKTQQKPKDNKK |
Ga0102823_10923053 | 3300007692 | Estuarine | MKGQTHGGKGSSQRPAEDSKKFASNWDAIFNKTQQKPKDKKEEDKK* |
Ga0102827_10078414 | 3300007715 | Estuarine | GQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDKKEEDKK* |
Ga0102867_11948791 | 3300007716 | Estuarine | GEQIMKGQTHGGKGSSQRPAEDSKKFSSNWDAIFNKTQQKPKDNKKEVKK* |
Ga0102904_11787462 | 3300007981 | Estuarine | QRPAEDSKKFSSNWDAIFNKTQQKPKDNKKELKK* |
Ga0075480_103033261 | 3300008012 | Aqueous | THGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDKKKELKK* |
Ga0075480_103120633 | 3300008012 | Aqueous | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDKKEEDRK* |
Ga0114916_10930021 | 3300008221 | Deep Ocean | SKEMKGQTHGGKGSTTRKTDSAKFASNWDAIYNKPAQKSSKKKK* |
Ga0111034_12598641 | 3300008517 | Marine Sediment | EASKEVKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAEKSSKKKK* |
Ga0102811_12080551 | 3300009024 | Estuarine | THGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDNKKELKK* |
Ga0102826_10012254 | 3300009054 | Estuarine | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPEDKKEEDKK* |
Ga0115549_12888201 | 3300009074 | Pelagic Marine | KASQEASKAMKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAEKSSKKKK* |
Ga0115550_11937711 | 3300009076 | Pelagic Marine | ASQEASKAMKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAKKSSKKANKA* |
Ga0115550_12913261 | 3300009076 | Pelagic Marine | QTHGGKGSATRKTDSAKFASNWDAIYNKPAQKSSKKKK* |
Ga0102814_102490491 | 3300009079 | Estuarine | MKGQTHGGKGSAQRSTDQKKFASNWDAIYNKTAQKSSKKKK* |
Ga0102814_104216442 | 3300009079 | Estuarine | MKHGQTHGGKGSSQRPTDGKKFASNWDVIFNKTQQKPKDKEKEVKK* |
Ga0102812_100911291 | 3300009086 | Estuarine | MKGQTHGGKGSTQRKTDSKKFASNWDAIYNKSTQKSSKKTNKA |
Ga0102812_101605301 | 3300009086 | Estuarine | MKHGQTHGGKGSSQRPTDGKKFASNWDVIFNKTQQKP |
Ga0102885_10298744 | 3300009142 | Estuarine | QTHGGKGSTQRKTDQKKFAANWDAIYNKTEQKSSKKTNKA* |
Ga0114994_100385734 | 3300009420 | Marine | MKGQTHGGKGSSQRKAADPKKFSSNWDAIYKKPVKKVKKK |
Ga0114994_102102232 | 3300009420 | Marine | MKGQTHGGKGSSQRKAADPKKFSSNWDAIYKKPVKKVKKK* |
Ga0115005_102406884 | 3300009432 | Marine | EMKGQTHGGKGSATRKTDSAKFASNWDAIYNKPSQKSSKKKK* |
Ga0115005_105390183 | 3300009432 | Marine | MKGQTHGGKGSTQRKTDSKKFGSNWDSIYKTPKKKKTVKK* |
Ga0115562_12308331 | 3300009434 | Pelagic Marine | GGKGSATRKTDSAKFASNWDAIYNKPAQKSSKKKK* |
Ga0115546_11953911 | 3300009435 | Pelagic Marine | GSATRKTDSAKFASNWDAIYNKPAKKSSKKANKA* |
Ga0115008_107426151 | 3300009436 | Marine | MKGQTHGGKGSATRKTDSAKFASSWDAIYNKPAKKSSKKANKA* |
Ga0115559_10186801 | 3300009438 | Pelagic Marine | ASQEASKAMKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAQKSSKKKK* |
Ga0115559_10595825 | 3300009438 | Pelagic Marine | KGQTHGGKGSAQRNTDSKKFAANYDAIFGKKKSDKKKK* |
Ga0115007_100128085 | 3300009441 | Marine | MKGQTHGGKGSATRKTDSAKFASNWDAIYNKPSQKSSKKKK* |
Ga0115571_10647981 | 3300009495 | Pelagic Marine | THGGKGSAQRNTDSKKFAANYDAIFGKKKSDKKKK* |
Ga0115571_13400903 | 3300009495 | Pelagic Marine | MKGQTHGGKGSTQRKTNSKKFAANWDAIYNKTTKKSSKNTNKA* |
Ga0115572_101064905 | 3300009507 | Pelagic Marine | MKGQTHGGKGSAQRKTDLKKFANNYDAIFGKKKADKKKK* |
Ga0115572_101867904 | 3300009507 | Pelagic Marine | MKGQTHGGKGSAQRKTDQKKFAANWDAIYNKNTTKSSK |
Ga0123573_101880221 | 3300009509 | Mangrove Sediment | MKGQTHGGKGSAQRKTDQKKFAANWDVIYNKNTTKSSKKKK* |
Ga0114999_100933171 | 3300009786 | Marine | MKGQTHGGKGSSQRKTADPKKFSSNWDAIYKKPVKKVKKK* |
Ga0136655_10033575 | 3300010316 | Freshwater To Marine Saline Gradient | MKGQTHGGKGSTQRKTDQKKFAANWDVIYNKTTEKSSKKKK* |
Ga0151674_10271542 | 3300011252 | Marine | MKGQTHGGKGSSQRPAEDSKKFSSNWDAIFNKTQQKPKDNKKEVKK* |
Ga0151675_10010255 | 3300011254 | Marine | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDKKKEVKK* |
Ga0151677_10144411 | 3300011258 | Marine | MKGQTHGGKGSAQRKTDQKKFASNWDAIYNKSIQKSSKQT |
Ga0116832_10409573 | 3300013231 | Marine | GKGSAQRKTDHKKFASNWDAIYNKTAQKSSKNKK* |
Ga0181387_10177865 | 3300017709 | Seawater | MKGQTHGGKGSAQRPAEDSKKFSSNWDAIFNKTQQKPKD |
Ga0181387_10307291 | 3300017709 | Seawater | MKGQTHGGKGSSQRKTDSKKFASNWDAIYNKPAEKSS |
Ga0181387_11258621 | 3300017709 | Seawater | TMKGQTHGGKGSAQRPAEDSKKFSSNWDAIFNKTQQKPKDKKEEDKK |
Ga0181390_10150306 | 3300017719 | Seawater | MKGQTHGGKGSSQRKTNSAKFASNWDAIYNKPAEKSSKKKK |
Ga0181390_10202432 | 3300017719 | Seawater | MKHGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDKKEEDKK |
Ga0181388_11269624 | 3300017724 | Seawater | MKGQTHGGKGSSQRKTDSKKFAANWDAIYNKTAQKSSKNK |
Ga0181401_10027978 | 3300017727 | Seawater | MKGQTHGGKGSSQRKTDSAKFASNWDAIYNKPAEKSSKKKK |
Ga0181401_10596805 | 3300017727 | Seawater | MKGQTHGGKGSSQRKTDSKKFAANWDAIYNKPAEKSSKNKK |
Ga0187222_10500642 | 3300017734 | Seawater | MQGQTHGGKGSGQRPTKDSKKFASNWDAIFNKTQQKPKDKEKEVKK |
Ga0181399_10282631 | 3300017742 | Seawater | ETMKGQTHGGKGSAQRKTDQKKFAANWDAIYNKTEQKSSKKKK |
Ga0181399_11062713 | 3300017742 | Seawater | GGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDKKEEDKK |
Ga0181397_11680661 | 3300017744 | Seawater | HGGKGSSQRKTDQKKFASNWDAIYNKTAQKSSKKKK |
Ga0181409_10167051 | 3300017758 | Seawater | WSTQRQETMKGQTHGGKGSSQRKTNSAKFASNWDAIYNKPAEKSSKKKK |
Ga0181413_12448891 | 3300017765 | Seawater | DRGEQIMKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDKKEEDKK |
Ga0187217_12019343 | 3300017770 | Seawater | MKGQTHGGKGSTQRKTDRKKFAANWDAIYNKATQKSSKKTNKA |
Ga0181430_10943161 | 3300017772 | Seawater | MKGQTHGGKGSSQRKTDSKKFAANWDAIYNKTTKNS |
Ga0181386_10625152 | 3300017773 | Seawater | MKGQTHGGKGSSQRKTDSKKFATNWDAIYNKTAQKSSKNKK |
Ga0181386_11939443 | 3300017773 | Seawater | MKGQTHGGKGSAQRPAEDSKKFSSNWDAIFNKTQQKPKDNKKELKK |
Ga0181395_11560042 | 3300017779 | Seawater | MKHGQTHGGKGSSQRPAEDSKKFASNWDAIFNKTQQKPKDNKKELKK |
Ga0181379_12997793 | 3300017783 | Seawater | MKGQTHGGKGSAQRKTDQKKFASNWDAIYNKTAQKSSK |
Ga0181553_101312594 | 3300018416 | Salt Marsh | MKGQTHGGKGSAQRPSNYVKYADNYDAIFNKQKPKDKKKEVKK |
Ga0188867_10004095 | 3300018642 | Freshwater Lake | MKGQNHGGKGSAQRKTDQKKFAANWDAIYNKNTTKSSKKKK |
Ga0188859_10101343 | 3300019098 | Freshwater Lake | GGKGSAQRKTDQKKFAANWDAIYNKNTTKSSKKKK |
Ga0193999_10136885 | 3300019718 | Sediment | MKGQTHGGKGSAQRKTDHKKFASNWDAIYNKTAQK |
Ga0194000_10001399 | 3300019750 | Sediment | MKGQTHGGKGSAQRKTDHKKFASNWDAIYNKTAQKSSKNKK |
Ga0206124_100290577 | 3300020175 | Seawater | MKGQTHGGKGSAQRKTDQKKFAANWDAIYNKNTTKSSKKKK |
Ga0206129_100237697 | 3300020182 | Seawater | MKGQTHGGKGSAQRKTDLKKFANNYDAIFGKKKADKKKK |
Ga0206677_100024627 | 3300021085 | Seawater | MKGQTHGGKGSSQRKTDSKKFAANWDAIYNKTAQKSSKNKK |
Ga0206682_100203024 | 3300021185 | Seawater | MKGQTHGGKGSSQRPAEDSKKFASNWDAIFNKTQQKPKDNKEVKK |
Ga0206682_101129362 | 3300021185 | Seawater | MKGQTHGGKGSAQRKTDQKKFAANWDAIYNKTEQKSSKKKK |
Ga0213869_1000239328 | 3300021375 | Seawater | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDNKKELKK |
Ga0213861_100088247 | 3300021378 | Seawater | MKGQTHGGKGSTQRKTDQKKFAANWDAIYNKNTTKSSKKTNKA |
Ga0213861_101591024 | 3300021378 | Seawater | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDKKEEDRK |
Ga0213861_105113082 | 3300021378 | Seawater | MKGQAHGGKGSAQRKTDQKKFAANWDAIYNKNTTKSSKKKK |
Ga0213868_101647992 | 3300021389 | Seawater | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDNKKEVKK |
Ga0222716_100478241 | 3300021959 | Estuarine Water | MKGQTHGGKGSAQRKTDQKKFASNWDAIYSKSIQKSSKKTNKA |
Ga0222716_101097394 | 3300021959 | Estuarine Water | MKGQTHGGKGSAQRSTDQKKFASNWDAIYNKTAQKSSKKKK |
Ga0222716_103913014 | 3300021959 | Estuarine Water | GGKGSTQRKTDSKKFASNWDAIYNKPAEKSSKNKK |
Ga0222716_104380003 | 3300021959 | Estuarine Water | AMKGQTHGGKGSSQRKTDSKKFSANWDAIYNKTTKKSSKNTNKA |
Ga0222715_105019501 | 3300021960 | Estuarine Water | KGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDNKKELKK |
Ga0212030_10058394 | 3300022053 | Aqueous | MKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAKKSSKKKK |
Ga0212030_10351983 | 3300022053 | Aqueous | MKGQTHGGKGSAQRKTDQKKFAANWDAIYNKNTTKSSKKN |
Ga0212030_10515831 | 3300022053 | Aqueous | MKGQTHGGKGSAQRKTDQKKFAANWDAIYNKNTTKSS |
Ga0212030_10552711 | 3300022053 | Aqueous | MKGQTHGGKGSAQRKTDQKKFAANWDAIYNKNTTKSSKKK |
Ga0212030_10695902 | 3300022053 | Aqueous | HGGKGSAQRKTDQKKFAANWDAIYNKNTTKSSKKKK |
Ga0212028_10439211 | 3300022071 | Aqueous | KKGQETMKGQTHGGKGSSQRKTDSKKFAANWDAIYNKPAQKSSKNKK |
Ga0196889_100012023 | 3300022072 | Aqueous | MKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAKKSSKKANKA |
Ga0196889_10068722 | 3300022072 | Aqueous | MKGQTHGGKGSTTRKTDSAKFASNWDAIYNKPAKKSSKKKK |
Ga0196903_10002858 | 3300022169 | Aqueous | MKGQTHGGKGSTQRKTDQKKFAANWDVIYNKTTEKSSKKKK |
Ga0196899_10419572 | 3300022187 | Aqueous | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDKKKELKK |
(restricted) Ga0233426_100077564 | 3300022920 | Seawater | MKGQTHGGKGSSQRKTDSKKFAANWDVIYNKTAQKSSKNKK |
(restricted) Ga0233411_102676572 | 3300023112 | Seawater | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDKKEEDKK |
(restricted) Ga0233412_104550441 | 3300023210 | Seawater | MKGQTHGGKGSSQRKTDQKKFASNWDAIYSKSIQKS |
Ga0232112_10302251 | 3300023693 | Seawater | KGQTHGGKGSAQRKTDQKKFAANWDAIYNKTEQKSSKKKK |
Ga0228682_10262141 | 3300023698 | Seawater | THGGKGSTQRKTDQKKFSANWDAIYNKSTQKSSKKTNKA |
(restricted) Ga0255039_103259554 | 3300024062 | Seawater | MKGQTHGGKGSTQRKTDSKKFAANWDAIYNKTTKKS |
(restricted) Ga0255039_103437114 | 3300024062 | Seawater | MKGQTHGGKGSSQRKTDQKKFASNWDAIYSKSIQKSSKKTNK |
(restricted) Ga0233444_101387721 | 3300024264 | Seawater | MKGQTHGGKGSAQRKTDSKKFAANWDAIYNKTAQKSSKNKK |
Ga0244775_100832867 | 3300024346 | Estuarine | MKHGQTHGGKGSSQRPTDGKKFASNWDVIFNKTQQKPKDKEKEVKK |
Ga0244775_114416931 | 3300024346 | Estuarine | MKGQTHGGKGSSQRKTDSKKFAANWDAVYNKTAQKSSKNKK |
Ga0244776_100169812 | 3300024348 | Estuarine | MKGQTHGGKGSSQRPAEDSKKFSSNWDAIFNKTQQKPKDNKKELKK |
Ga0244776_102042602 | 3300024348 | Estuarine | MKWGQTHGGKGSSQRKAADPKKFSSNWDAIYKKPVKKVKKKK |
(restricted) Ga0255049_104398281 | 3300024517 | Seawater | GQTHGGKGSSQRKAADPKKFSSNWDAIYKKPVKKVKKKK |
Ga0208667_100094610 | 3300025070 | Marine | MKGQTHGGKGSAQRSTDQKKFASNWDAIYNKTEQKSSKKKK |
Ga0208667_10221002 | 3300025070 | Marine | MQGQTHGGKGSGQRPTKDSKKFASNWDAIFNKTQQKPKDKKEEDRK |
Ga0208791_10341354 | 3300025083 | Marine | RQETMKGQTHGGKGSAQRKTDQKKFAANWDAIYNKTEQKSSKKKK |
Ga0208298_10823253 | 3300025084 | Marine | MKHGQTHGGKGSSQRPTDGKKFASNWDAIFNKTQQKPKDKEKEVKK |
Ga0208793_11240983 | 3300025108 | Marine | GGKGSAQRKTDQKKFAANWDAIYNKTEQKSSKKKK |
Ga0209557_10146722 | 3300025483 | Marine | MKGQTHGGKGSAQRKTDQKKFAVNWDAIYNKTEQKSSKKKK |
Ga0209195_10041575 | 3300025590 | Pelagic Marine | MKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAQKSSKKKK |
Ga0209138_10133701 | 3300025617 | Marine | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDNKEVKK |
Ga0209833_10075607 | 3300025641 | Pelagic Marine | GQTHGGKGSAQRNTDSKKFAANYDAIFGKKKSDKKKK |
Ga0208643_11464153 | 3300025645 | Aqueous | MKGQTHGGKGSAQRSTDQKKFASNWDAIYNKTAQKS |
Ga0208134_10295617 | 3300025652 | Aqueous | MKGQTHGGKGSSQRKTDQKKFASNWDAIYNKPIQKSSKQTNKA |
Ga0208134_11612423 | 3300025652 | Aqueous | MKGQTHGGKGSSQRKTDHKKFASNWDAIYNKTAQKSS |
Ga0209602_100261111 | 3300025704 | Pelagic Marine | MKGQTHGGKGSAQRKTDQKKFAANWDAIYNKNTTKSSKKNK |
Ga0209602_11845563 | 3300025704 | Pelagic Marine | SKAMKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAKKSSKKANKA |
Ga0208150_11597422 | 3300025751 | Aqueous | MKGQTHGGKGSSQRKTDSKKFAANWDAIYNKPAQKSSKNKK |
Ga0208427_11314604 | 3300025771 | Aqueous | MKGQTHGGKGSAQRKTDQKKFASNWDAIYNKTAQKSSKN |
Ga0209603_12279023 | 3300025849 | Pelagic Marine | QTHGGKGSAQRNTDSKKFAANYDAIFGKKKSDKKKK |
Ga0208645_10375155 | 3300025853 | Aqueous | MKGQTHGGKGSTQRKTDQKKFAANWGAIYNKNTTKSSKKTNNA |
Ga0208645_11879783 | 3300025853 | Aqueous | TMKGQTHGGKGSAQRSTDQKKFASNWDAIYNKTAQKSSKKKK |
Ga0209119_12302873 | 3300025860 | Pelagic Marine | KASQEASKAMKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAQKSSKKKK |
Ga0209666_13466752 | 3300025870 | Marine | MKHGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDNKKELKK |
Ga0209533_11913981 | 3300025874 | Pelagic Marine | KASQEASKAMKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAKKSSKKANKA |
Ga0209534_103350741 | 3300025880 | Pelagic Marine | SQEASKAMKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAKKSSKKANKA |
Ga0247559_10192945 | 3300026443 | Seawater | MKGQTHGGKGSAQRKTDQKKFAANWDAIYNKTTEKSSKKTNKA |
Ga0247598_10576865 | 3300026466 | Seawater | MKGQTHGGKGSAQRKTDQKKFAANWDAIYNKTEQKSSK |
Ga0247592_10258573 | 3300026500 | Seawater | MKGQTHGGKGSAQRKTDQKKFAANWDVIYNKNTTKSSKKKK |
Ga0208949_10140984 | 3300027315 | Marine | MKGQTHGGKGSSQRKTDSAKFASNWDAIYNKPAQKSSKKKK |
Ga0208950_10155701 | 3300027413 | Marine | MKGQTHGGKGSTQRKTDSKKFASNWDAIYNKPAEKSSKNKK |
Ga0209384_11326041 | 3300027522 | Marine | MKGQTHGGKGSATRKADSAKFASNWDAIYNKPAQKSSKKKK |
Ga0209482_10080941 | 3300027668 | Marine | MKGQTHGGKGSSTRKTDAAKFTSNWDAIYSKPAKKSSKDKK |
Ga0209383_11536391 | 3300027672 | Marine | KEQAEEAKVKGQTHGGKGSSQRKTDSAKFGANWDAIYNKSAQKSSKKKK |
Ga0209816_10006441 | 3300027704 | Marine | VKGQTHGGKGSTTRNTDAAKFSSNWDAIYSKPTKKSSKDKK |
Ga0209279_100003893 | 3300027771 | Marine | VKGQTHGGKGSTTRNTDAAKFSSNWDAIYSKPAKKSSKKKK |
Ga0209302_1000021835 | 3300027810 | Marine | MKGQTHGGKGSATRKTDSAKFASNWDAIYNKPSQKSSKKKK |
Ga0209302_102501943 | 3300027810 | Marine | VKGQTHGGKGSGQRKTDPKKFASNWDAIFKQPKKKTEKK |
Ga0209092_100405243 | 3300027833 | Marine | VKGQTHGGKGSGQRKTDLKKFASNWDAIFKQPKKKTEKK |
Ga0209712_102710971 | 3300027849 | Marine | MKGQTHGGKGSATRKTDSAKFASNWDAIYSKPAKKSSKK |
Ga0209712_107968382 | 3300027849 | Marine | MKGQTHGGKGSTQRKTDSKKFGSNWDSIYKTPKKKKTVKK |
(restricted) Ga0233415_102996353 | 3300027861 | Seawater | MKGQTHGGKGSTQRKTNSKKFAANWDAIYNKTTKKSSKNTNKA |
(restricted) Ga0255055_100837201 | 3300027881 | Seawater | GSTMKWGQTHGGKGSSQRKAADPKKFSSNWDAIYKKPVKKVKKKK |
Ga0247582_10938603 | 3300028109 | Seawater | ETVKGQTHGGKGSTQRKTNQKKFSANWDAIYNKSTQKSSKKTHKA |
Ga0256368_10220793 | 3300028125 | Sea-Ice Brine | MKGQTHGGKGSSQRKTADPKKFSSNWDAIYKKPVKKVKKK |
Ga0256368_10310731 | 3300028125 | Sea-Ice Brine | MKGQTHGGKGSSQRKTADSKKFSSNWDAIYKKPVKKVKKK |
Ga0228606_10094192 | 3300028135 | Seawater | MKGKTHGGKGSAQRKTDQKKFAANWDAIYNKTEQKSSKKKK |
Ga0307488_102122041 | 3300031519 | Sackhole Brine | MKGQTHGGKGSSQRKTDAAKFSANWDAIYSKPSKKSSKTKK |
Ga0307488_104686683 | 3300031519 | Sackhole Brine | MKGQTHGGKGSATRKTDSAKFASNWDAIYNKPAQKSSKKSNKA |
Ga0307488_106027812 | 3300031519 | Sackhole Brine | MKGQTHGGKGSSQRKAADPKKFSSNWDAIYKKPVKKVKKKK |
Ga0307489_105332091 | 3300031569 | Sackhole Brine | MKGQTHGGKGSSTRKTDAAKFSSNWDAIYSKPAKKSSKKKK |
Ga0307996_10967182 | 3300031589 | Marine | VKGQTHGGKGSTTRNTDAAKFSSNWDAIYSKPAKKSSK |
Ga0307994_10567374 | 3300031660 | Marine | MKGQTHGGKGSSQRKAADPKKFSSNWDAIYKKSVKKVKKK |
Ga0307995_11736591 | 3300031696 | Marine | ASKEMKGQTHGGKGSATRKTDSAKFASNWDAIYSKPTKKSSKKKK |
Ga0307995_12811852 | 3300031696 | Marine | MKGQTHGGKGSTTRKTDSAKFASNWDAIYNKPAQKSSKKKK |
Ga0316205_102145031 | 3300032257 | Microbial Mat | QIMKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDKKEEDRK |
Ga0316191_102217875 | 3300032258 | Worm Burrow | MKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDKMEEDKK |
Ga0316203_10681711 | 3300032274 | Microbial Mat | MKGQTHGGKGSSQRKTDSAKFASNWDAIYNKQAQKSSKKKK |
Ga0316202_101467262 | 3300032277 | Microbial Mat | VVLEQTDKGEQIMKGQTHGGKGSAQRPAEDSKKFASNWDAIFNKTQQKPKDNKKEVKK |
⦗Top⦘ |