NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F020786

Metagenome / Metatranscriptome Family F020786

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020786
Family Type Metagenome / Metatranscriptome
Number of Sequences 222
Average Sequence Length 38 residues
Representative Sequence MVGMALRPISHLTAWIVWHAARVSLLDDLERPRPPQNA
Number of Associated Samples 133
Number of Associated Scaffolds 222

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 44.04 %
% of genes near scaffold ends (potentially truncated) 15.77 %
% of genes from short scaffolds (< 2000 bps) 76.58 %
Associated GOLD sequencing projects 120
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.784 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.622 % of family members)
Environment Ontology (ENVO) Unclassified
(25.225 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.892 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.88%    β-sheet: 0.00%    Coil/Unstructured: 62.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 222 Family Scaffolds
PF09723Zn-ribbon_8 44.14
PF03816LytR_cpsA_psr 8.56
PF00587tRNA-synt_2b 4.50
PF00590TP_methylase 3.15
PF00480ROK 2.25
PF03129HGTP_anticodon 1.80
PF12680SnoaL_2 1.80
PF03176MMPL 1.35
PF04989CmcI 1.35
PF00884Sulfatase 1.35
PF09334tRNA-synt_1g 0.90
PF14248DUF4345 0.90
PF00561Abhydrolase_1 0.90
PF00196GerE 0.45
PF07452CHRD 0.45
PF02910Succ_DH_flav_C 0.45
PF10057MpsC 0.45
PF00486Trans_reg_C 0.45
PF00589Phage_integrase 0.45
PF00150Cellulase 0.45
PF00144Beta-lactamase 0.45
PF03354TerL_ATPase 0.45
PF01061ABC2_membrane 0.45
PF13460NAD_binding_10 0.45
PF01551Peptidase_M23 0.45
PF13683rve_3 0.45
PF12697Abhydrolase_6 0.45
PF13231PMT_2 0.45
PF00474SSF 0.45
PF04185Phosphoesterase 0.45

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 222 Family Scaffolds
COG1316Anionic cell wall polymer biosynthesis enzyme TagV/TagU, LytR-Cps2A-Psr (LCP) family (peptidoglycan teichoic acid transferase)Cell wall/membrane/envelope biogenesis [M] 8.56
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 4.50
COG0124Histidyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.80
COG0423Glycyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 1.80
COG0441Threonyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.80
COG0442Prolyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.80
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 1.35
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 1.35
COG3510Cephalosporin hydroxylaseDefense mechanisms [V] 1.35
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.90
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.90
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.90
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.90
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.90
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.90
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.45
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.45
COG2367Beta-lactamase class ADefense mechanisms [V] 0.45
COG2730Aryl-phospho-beta-D-glucosidase BglC, GH1 familyCarbohydrate transport and metabolism [G] 0.45
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.45
COG3934Endo-1,4-beta-mannosidaseCarbohydrate transport and metabolism [G] 0.45
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 0.45


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.78 %
UnclassifiedrootN/A16.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725001|GPWNP_F5MPXY301BXKV4All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium516Open in IMG/M
3300000532|CNAas_1007333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei716Open in IMG/M
3300000549|LJQas_1000721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei5261Open in IMG/M
3300000858|JGI10213J12805_11241022All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300000956|JGI10216J12902_109486196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei2137Open in IMG/M
3300000956|JGI10216J12902_111804860All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300001686|C688J18823_10270980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1122Open in IMG/M
3300004013|Ga0055465_10020194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium1517Open in IMG/M
3300004114|Ga0062593_101769716All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300005184|Ga0066671_10739276All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005539|Ga0068853_102050523All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005562|Ga0058697_10005615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4022Open in IMG/M
3300005562|Ga0058697_10799544Not Available510Open in IMG/M
3300005578|Ga0068854_100162737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1730Open in IMG/M
3300005719|Ga0068861_101443117All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300005843|Ga0068860_102103653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales586Open in IMG/M
3300005981|Ga0081538_10000935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia31514Open in IMG/M
3300005981|Ga0081538_10006415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10360Open in IMG/M
3300005981|Ga0081538_10017289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album5481Open in IMG/M
3300005981|Ga0081538_10030599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3650Open in IMG/M
3300005981|Ga0081538_10033197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3441Open in IMG/M
3300005981|Ga0081538_10041559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2916Open in IMG/M
3300005981|Ga0081538_10089586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1596Open in IMG/M
3300005981|Ga0081538_10213407Not Available775Open in IMG/M
3300005981|Ga0081538_10291353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300005981|Ga0081538_10294815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria598Open in IMG/M
3300006038|Ga0075365_10011283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter5249Open in IMG/M
3300006038|Ga0075365_10352875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1037Open in IMG/M
3300006038|Ga0075365_11192203Not Available536Open in IMG/M
3300006046|Ga0066652_100065939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2797Open in IMG/M
3300006058|Ga0075432_10012706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter2860Open in IMG/M
3300006058|Ga0075432_10271612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium695Open in IMG/M
3300006169|Ga0082029_1166616All Organisms → cellular organisms → Bacteria4410Open in IMG/M
3300006196|Ga0075422_10225308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300006844|Ga0075428_100235123All Organisms → cellular organisms → Bacteria1977Open in IMG/M
3300006844|Ga0075428_100284300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1780Open in IMG/M
3300006844|Ga0075428_100467927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1350Open in IMG/M
3300006844|Ga0075428_100921024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria927Open in IMG/M
3300006845|Ga0075421_100010719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album11333Open in IMG/M
3300006845|Ga0075421_100339391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1818Open in IMG/M
3300006845|Ga0075421_102437562All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300006846|Ga0075430_100113636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2257Open in IMG/M
3300006846|Ga0075430_100672632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter853Open in IMG/M
3300006847|Ga0075431_100189163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2110Open in IMG/M
3300006847|Ga0075431_101305093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium687Open in IMG/M
3300006880|Ga0075429_101640766All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300006894|Ga0079215_10130309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1165Open in IMG/M
3300006894|Ga0079215_10252227Not Available937Open in IMG/M
3300006894|Ga0079215_10582344Not Available724Open in IMG/M
3300006894|Ga0079215_10992768Not Available616Open in IMG/M
3300006918|Ga0079216_11057028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300007790|Ga0105679_10418640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1249Open in IMG/M
3300009094|Ga0111539_10514521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1394Open in IMG/M
3300009098|Ga0105245_10003187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales14669Open in IMG/M
3300009098|Ga0105245_11423926All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300009100|Ga0075418_10536807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium1257Open in IMG/M
3300009101|Ga0105247_10515922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales873Open in IMG/M
3300009147|Ga0114129_13126205Not Available540Open in IMG/M
3300009148|Ga0105243_10563870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1090Open in IMG/M
3300009148|Ga0105243_10874849All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300009148|Ga0105243_13027522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia510Open in IMG/M
3300009156|Ga0111538_11769515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter778Open in IMG/M
3300009551|Ga0105238_10568498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1139Open in IMG/M
3300009789|Ga0126307_10002771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia11889Open in IMG/M
3300009789|Ga0126307_10012005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album6341Open in IMG/M
3300009789|Ga0126307_10013541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5995Open in IMG/M
3300009789|Ga0126307_11129297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium634Open in IMG/M
3300009789|Ga0126307_11134739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales632Open in IMG/M
3300009789|Ga0126307_11369463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia573Open in IMG/M
3300009789|Ga0126307_11698682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia513Open in IMG/M
3300009840|Ga0126313_10020022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4437Open in IMG/M
3300009840|Ga0126313_10040940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3227Open in IMG/M
3300009840|Ga0126313_10056170All Organisms → cellular organisms → Bacteria2792Open in IMG/M
3300009840|Ga0126313_10312522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1231Open in IMG/M
3300009840|Ga0126313_10457640Not Available1018Open in IMG/M
3300009840|Ga0126313_11639347Not Available536Open in IMG/M
3300010036|Ga0126305_10181538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1326Open in IMG/M
3300010036|Ga0126305_11076233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium553Open in IMG/M
3300010038|Ga0126315_10534865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales751Open in IMG/M
3300010038|Ga0126315_10992345All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300010039|Ga0126309_10059251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1860Open in IMG/M
3300010039|Ga0126309_10100096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1491Open in IMG/M
3300010039|Ga0126309_10350927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium868Open in IMG/M
3300010039|Ga0126309_10526582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales732Open in IMG/M
3300010039|Ga0126309_10529575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album730Open in IMG/M
3300010039|Ga0126309_10842288All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300010039|Ga0126309_10856654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia598Open in IMG/M
3300010040|Ga0126308_10024257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3310Open in IMG/M
3300010040|Ga0126308_10174419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1370Open in IMG/M
3300010040|Ga0126308_10384444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales934Open in IMG/M
3300010041|Ga0126312_10000026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia52802Open in IMG/M
3300010041|Ga0126312_10000506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia23425Open in IMG/M
3300010041|Ga0126312_10009054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6667Open in IMG/M
3300010041|Ga0126312_11130956Not Available576Open in IMG/M
3300010042|Ga0126314_10338562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1078Open in IMG/M
3300010042|Ga0126314_10550160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales840Open in IMG/M
3300010042|Ga0126314_11159909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales576Open in IMG/M
3300010044|Ga0126310_10106020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1713Open in IMG/M
3300010044|Ga0126310_10835684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales711Open in IMG/M
3300010399|Ga0134127_12085322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales645Open in IMG/M
3300010403|Ga0134123_12379779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia594Open in IMG/M
3300011000|Ga0138513_100005596All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1417Open in IMG/M
3300011000|Ga0138513_100011979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1101Open in IMG/M
3300012042|Ga0136627_1081668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae1120Open in IMG/M
3300012045|Ga0136623_10150888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1007Open in IMG/M
3300012091|Ga0136625_1049886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1515Open in IMG/M
3300012185|Ga0136619_10109114All Organisms → cellular organisms → Bacteria → Terrabacteria group1060Open in IMG/M
3300012186|Ga0136620_10005527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5964Open in IMG/M
3300012187|Ga0136622_10328354All Organisms → cellular organisms → Bacteria → Terrabacteria group641Open in IMG/M
3300012204|Ga0137374_10097601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2783Open in IMG/M
3300012529|Ga0136630_1068332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1323Open in IMG/M
3300012895|Ga0157309_10307875Not Available537Open in IMG/M
3300012907|Ga0157283_10105771All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300012915|Ga0157302_10503179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales524Open in IMG/M
3300012939|Ga0162650_100072707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium587Open in IMG/M
3300014311|Ga0075322_1137624Not Available593Open in IMG/M
3300014314|Ga0075316_1133373Not Available616Open in IMG/M
3300014326|Ga0157380_11897386All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300014487|Ga0182000_10425363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300014487|Ga0182000_10505100All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300014488|Ga0182001_10309295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia644Open in IMG/M
3300014488|Ga0182001_10583458All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300015077|Ga0173483_10595300Not Available607Open in IMG/M
3300015371|Ga0132258_10337325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3723Open in IMG/M
3300015371|Ga0132258_10846827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2307Open in IMG/M
3300015371|Ga0132258_10940076All Organisms → cellular organisms → Bacteria2183Open in IMG/M
3300015373|Ga0132257_101648947All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300017787|Ga0183260_10014570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6039Open in IMG/M
3300017787|Ga0183260_10560174Not Available738Open in IMG/M
3300017792|Ga0163161_10252203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1376Open in IMG/M
3300018054|Ga0184621_10351852All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300018061|Ga0184619_10026540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2414Open in IMG/M
3300018066|Ga0184617_1032399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1246Open in IMG/M
3300018066|Ga0184617_1265576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales515Open in IMG/M
3300018073|Ga0184624_10248806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia797Open in IMG/M
3300018422|Ga0190265_10021524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album5160Open in IMG/M
3300018422|Ga0190265_10951581All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300018422|Ga0190265_11042850All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300018422|Ga0190265_11158601Not Available892Open in IMG/M
3300018432|Ga0190275_10000017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia286969Open in IMG/M
3300018432|Ga0190275_10465832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1290Open in IMG/M
3300018432|Ga0190275_10917521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria944Open in IMG/M
3300018465|Ga0190269_10737632All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300018465|Ga0190269_11575877All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300018466|Ga0190268_10103479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1330Open in IMG/M
3300018466|Ga0190268_10428428Not Available865Open in IMG/M
3300018466|Ga0190268_10592042All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300018466|Ga0190268_11002361All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300018469|Ga0190270_10018789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album4198Open in IMG/M
3300018469|Ga0190270_10668609All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300018469|Ga0190270_11726852Not Available680Open in IMG/M
3300018469|Ga0190270_12772423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales553Open in IMG/M
3300018469|Ga0190270_12911378Not Available541Open in IMG/M
3300018476|Ga0190274_10361974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1386Open in IMG/M
3300018476|Ga0190274_11106644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter872Open in IMG/M
3300018481|Ga0190271_10008999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6932Open in IMG/M
3300018481|Ga0190271_11262275All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300019356|Ga0173481_10065550All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300019356|Ga0173481_10111498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1070Open in IMG/M
3300019356|Ga0173481_10218261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia838Open in IMG/M
3300019362|Ga0173479_10170522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium890Open in IMG/M
3300019377|Ga0190264_11009541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia666Open in IMG/M
3300019767|Ga0190267_10940449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia598Open in IMG/M
3300020020|Ga0193738_1060323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1132Open in IMG/M
3300021184|Ga0196959_10053298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales846Open in IMG/M
3300022756|Ga0222622_10190478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1354Open in IMG/M
3300022756|Ga0222622_10369327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1004Open in IMG/M
3300025567|Ga0210076_1045762All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300025792|Ga0210143_1008234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1927Open in IMG/M
3300025900|Ga0207710_10468194All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria652Open in IMG/M
3300025907|Ga0207645_10091323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae1958Open in IMG/M
3300025920|Ga0207649_11221023Not Available594Open in IMG/M
3300025935|Ga0207709_11019574Not Available677Open in IMG/M
3300025981|Ga0207640_10475684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1035Open in IMG/M
3300026041|Ga0207639_10740401All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300026075|Ga0207708_10057681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2962Open in IMG/M
3300026118|Ga0207675_101718869All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300027639|Ga0209387_1183535Not Available566Open in IMG/M
3300027809|Ga0209574_10000242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia14941Open in IMG/M
3300027886|Ga0209486_10676709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia663Open in IMG/M
3300027907|Ga0207428_10016300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia6395Open in IMG/M
3300027909|Ga0209382_11536002All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300028004|Ga0247705_1003781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1797Open in IMG/M
3300028005|Ga0247708_1004459All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300028005|Ga0247708_1031671All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300028007|Ga0247718_1053655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1051Open in IMG/M
3300028587|Ga0247828_11012723Not Available543Open in IMG/M
3300028589|Ga0247818_10754928Not Available677Open in IMG/M
3300028705|Ga0307276_10064763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales835Open in IMG/M
3300028717|Ga0307298_10102232Not Available815Open in IMG/M
3300028722|Ga0307319_10182394All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300028722|Ga0307319_10321238Not Available513Open in IMG/M
3300028754|Ga0307297_10016377All Organisms → cellular organisms → Bacteria2038Open in IMG/M
3300028796|Ga0307287_10228335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter706Open in IMG/M
3300028796|Ga0307287_10393403Not Available522Open in IMG/M
3300028875|Ga0307289_10154887Not Available942Open in IMG/M
3300028875|Ga0307289_10479135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales511Open in IMG/M
3300028878|Ga0307278_10250388Not Available786Open in IMG/M
3300031092|Ga0308204_10238910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300031161|Ga0310837_102230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album7347Open in IMG/M
3300031228|Ga0299914_10015668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album5999Open in IMG/M
3300031229|Ga0299913_10004536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia11672Open in IMG/M
3300031548|Ga0307408_100340462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae1269Open in IMG/M
3300031731|Ga0307405_10052365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2537Open in IMG/M
3300031731|Ga0307405_11923233All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300031852|Ga0307410_10586810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium928Open in IMG/M
3300031938|Ga0308175_100365322All Organisms → cellular organisms → Bacteria1496Open in IMG/M
3300031995|Ga0307409_100082475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2603Open in IMG/M
3300031995|Ga0307409_102937213Not Available503Open in IMG/M
3300032002|Ga0307416_103474162Not Available527Open in IMG/M
3300032005|Ga0307411_12294094Not Available507Open in IMG/M
3300032159|Ga0268251_10043095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1452Open in IMG/M
3300033550|Ga0247829_10365508All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300033550|Ga0247829_11479891All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300033551|Ga0247830_11005474All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300034144|Ga0334962_001758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2245Open in IMG/M
3300034172|Ga0334913_031780All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300034172|Ga0334913_073863All Organisms → cellular organisms → Bacteria720Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.62%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil16.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.46%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand4.50%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere4.50%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.60%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.70%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.80%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.80%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave1.80%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.35%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil1.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.35%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.35%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.35%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.35%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.90%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.90%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.90%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.90%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.45%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.45%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.45%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.45%
RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.45%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.45%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.45%
Plant BiomassHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Plant Biomass0.45%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725001Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000532Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_AssembledHost-AssociatedOpen in IMG/M
3300000549Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_AssembledHost-AssociatedOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007790Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projectsEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012042Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06)EnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012091Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06)EnvironmentalOpen in IMG/M
3300012185Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06)EnvironmentalOpen in IMG/M
3300012186Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06)EnvironmentalOpen in IMG/M
3300012187Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06)EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012529Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06)EnvironmentalOpen in IMG/M
3300012531Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ864 (21.06)EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300013013Gypsum rock endolithic microbial communities from the Atacama Desert, Chile - MonturaquiEnvironmentalOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300021184Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025567Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025792Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028004Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-2-W_NEnvironmentalOpen in IMG/M
3300028005Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-2-W_NEnvironmentalOpen in IMG/M
3300028007Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-1-E_DEnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031161Sorghum-adapted microbial communities enriched on stacked mutant (SM) sorghum from Joint BioEnergy Institute, Emeryville, California, United States - SM_Day14_5Host-AssociatedOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034144Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 58SNSEnvironmentalOpen in IMG/M
3300034172Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPWNP_001429302067725001SoilMIGTALRPIGHLAAWLVWHTTRVSLLADLKSPRPPHAE
CNAas_100733313300000532Quercus RhizosphereRSEPMVGTALRPISHLTAWVVWHAMRVSLLADLERPQPPQSA*
LJQas_100072143300000549Quercus RhizosphereMSNALRPIGHFAAWIVWHSTGVSLLGDLKSPRPPRG*
JGI10213J12805_1124102233300000858SoilMVTTALRPLGHLAAWLVWHSMRVSLLHDLERPSPPAD*
JGI10216J12902_10948619633300000956SoilMALRPLSHLTAWIVWHAARVSLLEDLDSPKPPRSA*
JGI10216J12902_11180486023300000956SoilMVNLALRPIGHLAAWLVWHSVRVSLYDDLQRPRPPF*
C688J18823_1027098023300001686SoilMVGMALRPLSHLTAWIVWHAARVSLLEDLERPKPPRSA*
Ga0055465_1002019423300004013Natural And Restored WetlandsPDMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPRAA*
Ga0062593_10176971623300004114SoilRWGTFGSMVGMALRPISHLTAWIVWHAARVSLLDDLERPRPPQNA*
Ga0066671_1073927623300005184SoilMARLALRPIGHLTAWLVWHSTRVSLLADLDEPRPPHGED*
Ga0068853_10205052323300005539Corn RhizosphereGGKLRSMVGMALRPISHLTAWIVWHAARVSLLDDLDAPSPPRNA*
Ga0058697_1000561533300005562AgaveMIAAALRPIGHFAAWLLWHTARVSLLSDLERPRPPHAR*
Ga0058697_1079954413300005562AgaveMSTALRPFGHLAAWIVWHAMRVSLLDDLDRPRPPHRG*
Ga0068854_10016273723300005578Corn RhizosphereMVGMALRPISHLTAWIVWHAARVSLLDDLDSPKPPRNA*
Ga0068861_10144311743300005719Switchgrass RhizosphereWGRFGVMVGMALRPLSHLTAWIVWHAARVSLLDDLDNPKPPQSA*
Ga0068860_10210365323300005843Switchgrass RhizosphereMALRPLSHLTAWIVWHAARVSLLDDLDNPKPPQSA*
Ga0081538_10000935203300005981Tabebuia Heterophylla RhizosphereMIGIALRPIGHLAAWLVWHTTRISILRDLERPRPPA*
Ga0081538_1000641583300005981Tabebuia Heterophylla RhizosphereMVTTALRPFGHIAAWLVWHSMRVSLLGDLERPQPPAD*
Ga0081538_1001728923300005981Tabebuia Heterophylla RhizosphereMVTTALRPFGHLAAWIVWHSMRVSLLGDLERPQPPTD*
Ga0081538_1003059933300005981Tabebuia Heterophylla RhizosphereMIGTALRPIGHLAAWIVWHTTRVSLLSDLEHPRPPHGR*
Ga0081538_1003319753300005981Tabebuia Heterophylla RhizosphereMVGIALRPIGHLAAWLWWHTTRVSLLSDLERPRPPRGS*
Ga0081538_1004155943300005981Tabebuia Heterophylla RhizosphereMIGTALRPIGHLAAWLVWHTTRVSLLSDLERPRPPRDR*
Ga0081538_1008958623300005981Tabebuia Heterophylla RhizosphereMATVFRPIGHIAAWIAWHTMRVSLLDDLERPQPPG*
Ga0081538_1021340723300005981Tabebuia Heterophylla RhizosphereMVTTALRPFGHIAAWVVWHSMRVSLLGDLERPRPPAD*
Ga0081538_1029135323300005981Tabebuia Heterophylla RhizosphereMGSALRPISHLTAWLVWHTMRVSLLDDLERPQPPHAA*
Ga0081538_1029481523300005981Tabebuia Heterophylla RhizosphereMYRGRAMATALRPISHLTAWLVWHAMRVSLLDDLDQPAPPHDA*
Ga0075365_1001128333300006038Populus EndosphereVVGIALKPFGHIAAWIVWHAARVSLKDDLERPSPPHAA*
Ga0075365_1035287523300006038Populus EndosphereMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPRSG*
Ga0075365_1119220313300006038Populus EndosphereMATAFRPIGHIAAWIVWHATRVSLLADLERPQPPRPG*
Ga0066652_10006593923300006046SoilMVTTALRPIGHLAAWLLWQSMRVSLLDDLDSPRPPGTL*
Ga0075432_1001270633300006058Populus RhizosphereMVGMALRPLSHLTAWIVWHAARVSLLEDLDSPKPPPGA*
Ga0075432_1027161223300006058Populus RhizosphereMVGMALRPLSHLTAWIVWHATRVSLLEDLESPKPPQNA*
Ga0082029_116661643300006169Termite NestMVGLALRPISHLTAWLVWHAARVSLLDDLDSPKPPQNA*
Ga0075422_1022530813300006196Populus RhizosphereVMVGMALRPLSHLTAWIVWHATRVSLLEDLESPKPPQNA*
Ga0075428_10023512333300006844Populus RhizosphereMVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPRNA*
Ga0075428_10028430033300006844Populus RhizosphereMATAFRPIGHIAAWIVWHAMRVSLLEDLERPQPPRSG*
Ga0075428_10046792723300006844Populus RhizosphereMVGMALRPLSHLTAWIVWHAARVSLLEDLDSPKPPQNA*
Ga0075428_10092102433300006844Populus RhizosphereMVGMALRPISHLTAWIVWHAARVSLLDDLERPRPPQNA*
Ga0075421_10001071993300006845Populus RhizosphereMVGTALRPLGHLAAWLVWHTVRVSLLRDLERPEPPRDD*
Ga0075421_10033939123300006845Populus RhizosphereMATALRPFGHIAAWIVWHAMRVSLLDDLDRPAPPG*
Ga0075421_10243756233300006845Populus RhizosphereMATAFRPIGHIAAWIVWHAMRVSLLDDLDRPQPPAAR*
Ga0075430_10011363643300006846Populus RhizosphereAFRPIGHIAAWIVWHAMRVSLLEDLERPQPPRSG*
Ga0075430_10067263233300006846Populus RhizosphereAGVVGIALKPFGHIAAWIVWHAARVSLKDDLERPSPPHAA*
Ga0075431_10018916333300006847Populus RhizosphereMALRPISHLTAWIVWHAARVSLLDDLERPRPPQNA*
Ga0075431_10130509323300006847Populus RhizosphereMVGMALRPLSHLTAWIVWHATRVSLLEDLERPKPPQNA*
Ga0075429_10164076613300006880Populus RhizosphereSMVGMALRPISHLTAWIVWHAARVSLLDDLERPRPPQNA*
Ga0079215_1013030923300006894Agricultural SoilMVGMALRPISHLTAWIVWHAARVSLLEDLDSPRPPQNA*
Ga0079215_1025222723300006894Agricultural SoilMALRPISHLTAWIVWHAARVSLLEDLDSPRPPQNA*
Ga0079215_1058234423300006894Agricultural SoilMVGTALRPISHLTAWFVWHAMRVSLLEDLESPKPPRSA*
Ga0079215_1099276823300006894Agricultural SoilVLGTALRPTSHLTAWLVWHAMRVSLLDDLEQPRPPHTV*
Ga0079216_1105702823300006918Agricultural SoilSRGSFASMVGLALGPISHLAAWLVWHAARVSLLADLDSPKPPQSA*
Ga0105679_1041864023300007790SoilMGTALRPIGHIAAWIVWHAMRVSLLDDLDRPQPPTAR*
Ga0111539_1051452113300009094Populus RhizosphereSMVGMALRPISHLTAWIVWHAARVSLLDDLDAPSPPRNA*
Ga0105245_10003187133300009098Miscanthus RhizosphereMVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPQNA*
Ga0105245_1142392633300009098Miscanthus RhizosphereGGLEGYLAAVVGTALKPFGHLAAWIVWHAARVSLLDDLKRPSPPHAG*
Ga0075418_1053680733300009100Populus RhizosphereMVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPRNV*
Ga0105247_1051592223300009101Switchgrass RhizosphereMALRPISHLTAWIVWHATRVSLLEDLESPKPPPNA*
Ga0114129_1312620513300009147Populus RhizosphereVVGTALKPFGHLAAWIVWHAARVSLLDDLKRPSPPHAG*
Ga0105243_1056387033300009148Miscanthus RhizosphereMVGMALRPISHLTAWIVWHAARVSLLDDLDAPSPPRNA*
Ga0105243_1087484913300009148Miscanthus RhizosphereMATAFRPIGHIAAWIVWHAMRVSLLDDLERPAPPG*
Ga0105243_1302752223300009148Miscanthus RhizosphereMNTALRPFGHLAAWILWHTMRVSVLDDLERPQPPHRG*
Ga0111538_1176951523300009156Populus RhizosphereMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPAAR*
Ga0105238_1056849813300009551Corn RhizosphereALRPLSHLTAWIVWHATRVSLLEDLESPKPPQNA*
Ga0126307_10002771113300009789Serpentine SoilMVRTAFSPISHLAAWILWHTARVSLLRDLDEPEPPHAA*
Ga0126307_1001200573300009789Serpentine SoilMYPGGAGWGTFAAMVGMALRPLSHLTAWLVWHAARVSLLDDLDSPSPPQNA*
Ga0126307_10013541103300009789Serpentine SoilMVGLALRPISHLTAWLVWHAARVSLLEDLDRPKPPQNG*
Ga0126307_1112929713300009789Serpentine SoilMCQFVRDWGTFAAMVGMALRPLSHLTAWIVWHAARVSLLDDLDSPNPPQNA*
Ga0126307_1113473923300009789Serpentine SoilMVGTALKPFGHLAAWILWHTARISLLDDLKRPSPPHAG*
Ga0126307_1136946323300009789Serpentine SoilMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPQAG*
Ga0126307_1169868223300009789Serpentine SoilMVETALRPVSHIAAWLMWHCMRVSLLEDLERPRPPAP*
Ga0126313_1002002223300009840Serpentine SoilMVGLALRPISHLTAWLVWHAARVSLLDDLDSPKPPQSA*
Ga0126313_1004094023300009840Serpentine SoilMGTALRPFGHIAAWILWHAMRVSLLDDLDRPRPPHPG*
Ga0126313_1005617023300009840Serpentine SoilMVGIALRPIGHLAAWLVWHTTRVSLLSDLERPRPPH*
Ga0126313_1031252223300009840Serpentine SoilMVGMALRPLSHLTAWIVWHAARVSLLDDLDSPKPPRNA*
Ga0126313_1045764023300009840Serpentine SoilMVGLALRPISHLTAWIVWHAARVSLLEDLDSPKPPRN*
Ga0126313_1163934713300009840Serpentine SoilMVGTALRPIGHIAAWLVWQTMRVSLLHDLERPRPPQ*
Ga0126305_1018153833300010036Serpentine SoilMGTALRPISHIAAWILWHSMRVSLLDDLERPRPPHPH*
Ga0126305_1107623313300010036Serpentine SoilMVGLALRPISHLTAWLVWHAARVSLLEDLDSPKPPPNA*
Ga0126315_1053486523300010038Serpentine SoilMVGTALRPIGHFAAWLVWHTMRVSLLHDLERPRPPHAAGE*
Ga0126315_1099234513300010038Serpentine SoilMATAFRPIGHIAAWIVWHAMRVSLLDDLERPEPPHPE*
Ga0126309_1004378323300010039Serpentine SoilMLRTAFRPVRHVTAWLVWHAAGVSLLEDLEQPRPPS*
Ga0126309_1005925123300010039Serpentine SoilMVGMALRPLSHLTAWIVWHAARVSLLEDLESPEPPRNA*
Ga0126309_1010009633300010039Serpentine SoilMVGTALRPISHLTAWVVWHAIRVSLLEDLERPEPPQSA*
Ga0126309_1035092713300010039Serpentine SoilMGTALRPIGHIAAWIVWHAMRVSLLDDLDRPRPPAS*
Ga0126309_1052658223300010039Serpentine SoilMVGMALRPLSHLTAWIVWHAARVSLLEDLDSPNPPRNA*
Ga0126309_1052957523300010039Serpentine SoilMVGLALKPFSHLAAWLVWHSMRVSLLEDLDAPSPPT*
Ga0126309_1084228823300010039Serpentine SoilMGIALRPIGHIAAWILWQAMRVSLLDDLERPSPPQVR*
Ga0126309_1085665423300010039Serpentine SoilMARYALRPISHLAAWLVWHSTRVSLLADLDEPRPPQPEE*
Ga0126308_1002425723300010040Serpentine SoilMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPHPG*
Ga0126308_1017441923300010040Serpentine SoilMATAFRPIGHIAAWIVWHAMRVSLLDDLDRPQPPQG*
Ga0126308_1038444423300010040Serpentine SoilMVGTALKPLGHLAAWIVWHAARVSLLHDLERPSPPRAG*
Ga0126312_10000026353300010041Serpentine SoilVIAEAMVTTALRPIGHLAAWLLWQSMRVSLLDDLESPKPPGGA*
Ga0126312_10000506123300010041Serpentine SoilMVSLALRPIGHLAAWLVWHAARVSLLDDLEQPRPPY*
Ga0126312_1000905473300010041Serpentine SoilMVGMALRPLSHLTAWIVWHATRVSLLEDLESPRPPQNA*
Ga0126312_1113095623300010041Serpentine SoilMLGSMVGMALRPLSHLTAWIVWHAARVSLLEDLDSPNPPRNA*
Ga0126314_1033856233300010042Serpentine SoilMATALRPIGHIAAWIVWHAMRVSLLDDLERPQPPHVG*
Ga0126314_1055016023300010042Serpentine SoilMATALRPIGHIAAWIVWHAMRVSLLDDLERPAPPG*
Ga0126314_1115990923300010042Serpentine SoilMCQFVRDWGTFAAMVGMALRPLSHLTPWIVWHAARVSLLEDLDSPNPPQNA*
Ga0126310_1010602043300010044Serpentine SoilMATALRPIGHIAAWLVWHAMRVSLLDDLDRPAPP*
Ga0126310_1083568433300010044Serpentine SoilMVGMALRPLSHLTAWLVWHAARVSLLDDLDSPSPPQNA*
Ga0134127_1208532223300010399Terrestrial SoilMALRPISHLTAWIVWHAARVSLLDDLDAPSPPRNA*
Ga0134123_1237977923300010403Terrestrial SoilMVGMALRPLSHLTAWIVWHAARVSLLEDLDSPKPPPTA*
Ga0138513_10000559623300011000SoilMVGMALRPLSHLTAWIVWHATRVSLLDDLDSPKPPQNA*
Ga0138513_10001197933300011000SoilMVVSALRPIGHIAAWLVWHSTRVSLLRDLEEPQPPAG*
Ga0136627_108166833300012042Polar Desert SandMVILRPIEHIAAWVVWHSTRVSLLDDLDDPSPPES*
Ga0136623_1015088833300012045Polar Desert SandMVSHALRATSHLTAWIVWHSLRVSLLDDLEDPHPPSEA*
Ga0136625_104988633300012091Polar Desert SandMVSHALRATSHLTAWIVWHSLRVSLLDDLEDPRPPSEA*
Ga0136619_1010911423300012185Polar Desert SandMVFHALRATSHLTAWIVWHSLRVSLLDDLEDPHPPSEA*
Ga0136620_1000552743300012186Polar Desert SandMVSHALRATSHLTAWIVWHSLRVSLLDDLDEPRPPEEA*
Ga0136622_1032835423300012187Polar Desert SandMVSHALRATSHLTAWIVWHSLRVSLLDDLDDPRPPAEA*
Ga0137374_1009760123300012204Vadose Zone SoilMVGLALRPISHLTAWIVWHAARVSLLEDLDSPKPPQNA*
Ga0136630_106833233300012529Polar Desert SandMVFHALRATSHLTAWIVWHSLRVSLLDDLEDPRPPSEA*
Ga0136640_1009622523300012531Polar Desert SandVIAMVRTAFRPVRHVTAWLLWHAAGVSLLEDLEQPR
Ga0157309_1030787523300012895SoilMATALRPFGHLAAWIVWHAMRVSLLDDLERPAPPG*
Ga0157283_1010577123300012907SoilMALRPLSHLTAWIVWHAARVSLLEDLDSPKPPPGA*
Ga0157302_1050317923300012915SoilMSTALRPFGHLAAWIVWHAMRVSLLDDLERPQPPHRG*
Ga0162650_10007270713300012939SoilSTAVAGRVGVMVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPQNA*
Ga0169969_101523533300013013RockMVIFRPIGHLAAWIVWHSARVSLLDDLEAPSPPAA*
Ga0075322_113762413300014311Natural And Restored WetlandsMATALRPIGHIAAWIVWHAMRVSLLDDLEGPAPPG*
Ga0075316_113337323300014314Natural And Restored WetlandsMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPRAA*
Ga0157380_1189738613300014326Switchgrass RhizosphereVVGIALKPFGHIAAWIVWHAVRVSLKDDLERPSPPHAA*
Ga0182000_1042536323300014487SoilMVGLALRPISHLTAWIVWHATRVSLLEDLDSPKPPQNA*
Ga0182000_1050510033300014487SoilVAAMVTTALRPFGHIAAWLVWHSMRVSLLGDLERPQPPAD*
Ga0182001_1030929523300014488SoilMVGLALKPFSHVAAWLVWHSMRVSLLDDLDVPSPPS*
Ga0182001_1058345823300014488SoilMVGMALRPISHLTAWIVWHAARVSLLDDLDSPKPPQNA*
Ga0173483_1059530013300015077SoilGMALRPLSHLTAWIVWHAARVSLLEDLDSPSPPRNA*
Ga0132258_1033732523300015371Arabidopsis RhizosphereMALRPLSHLTAWIVWHATRVSLLEDLESPKPPQNA*
Ga0132258_1084682723300015371Arabidopsis RhizosphereMVGMALRPLSHLTAWIVWHATRVSLLEDLESPKPPPNA*
Ga0132258_1094007623300015371Arabidopsis RhizosphereMATALRPFGHIAAWIVWHAVRVSLLDDLDRPAPPG*
Ga0132257_10164894713300015373Arabidopsis RhizosphereMVGSALRPFGHLAAWLVWHAARVSILRDLDRPEPPHVA*
Ga0183260_1001457053300017787Polar Desert SandMVSHALRATSHLTAWIVWHSLRVSLLDDLDEPRPPEEA
Ga0183260_1056017413300017787Polar Desert SandMVSHALRATSHLTAWIVWHSLRVSLLDDLEDPRPPSEA
Ga0163161_1025220313300017792Switchgrass RhizospherePFVRSWGRFGVMVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPQNA
Ga0184621_1035185213300018054Groundwater SedimentFRTMVGMALRPLSHLTAWIVWHAARVSLLEDLESPRPPKNA
Ga0184619_1002654013300018061Groundwater SedimentMVGMALRPISHLTAWIVWHAARVSLLDDLDRPKPPQNA
Ga0184617_103239933300018066Groundwater SedimentMVETALRPVSHLAAWLMWHCMRVSLLEDLERPRPPAP
Ga0184617_126557623300018066Groundwater SedimentMVASALRPIGHIAAWLVWHSTRVSLLRDLEEPQPPAG
Ga0184624_1024880623300018073Groundwater SedimentMVVSALRPIGHIAAWLLWHSTRVSLLRDLEEPQPPAG
Ga0190265_1002152423300018422SoilMVGMALRPISHLTAWIVWHAARVSLLEDLDRPRPPKNA
Ga0190265_1095158133300018422SoilMVGNALKPFGHLAAWLVWHSMRVSLLDDLDAPQPPS
Ga0190265_1104285033300018422SoilMVGMALRPLSHLTAWIVWHAARVSLLEDLDSPNPPRNA
Ga0190265_1115860123300018422SoilMVETALRPVSHIAAWLMWHCMRVSLLDDLERPRPPGD
Ga0190275_10000017363300018432SoilMVTNAFRPIGHIAAWIVWHSTGVSLLRDLEAPQPPRD
Ga0190275_1046583233300018432SoilMVGYALKPIGHIAAWLVWHATRVSLLDDLDAPEPPS
Ga0190275_1091752123300018432SoilMVGTAFKPIGHLAAWIVWHATRVSLLDDLKRPQPPRRT
Ga0190269_1073763233300018465SoilMVAPLRPIGHLAAWIVWHSMRVSLLDDLDRPCPPSG
Ga0190269_1157587723300018465SoilWRQMVETALRPVSHIAAWLMWHCMRVSLLEDLERPRPPAP
Ga0190268_1010347923300018466SoilMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPRSG
Ga0190268_1042842823300018466SoilMVGLALRPISHLTAWLVWHAARVSLLDDLDSPKPPQNA
Ga0190268_1059204223300018466SoilMVETALRPVSHIAAWLMWHCMRVSLLEDLERPRPPAP
Ga0190268_1100236123300018466SoilMVGMALRPLSHLTAWIVWHAARVSLLDDLDSPSPPA
Ga0190270_1001878963300018469SoilMVTTALRPFGHIAAWLVWHSMRVSLLEDLERPEPPVG
Ga0190270_1066860913300018469SoilMATAFRPIGHIAAWIVWHAMRVSLLDDLERPKPPQSA
Ga0190270_1172685223300018469SoilMLGYFRTMVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPKNA
Ga0190270_1277242323300018469SoilMGTAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPHPG
Ga0190270_1291137813300018469SoilMVGTALRPLGHLAAWLVWHAARVSLLRDLERPEPPHGA
Ga0190274_1036197423300018476SoilMVTTALRPFGHIAAWLVWHSMRVSLLEDRERPEPPVG
Ga0190274_1110664423300018476SoilMATAFRPIGHIAAWIVWHAMRVSLLDDLEHPQPPHPG
Ga0190271_1000899923300018481SoilMGTALRPISHLTAWLVWHAMRVSLLDDLERPAPPHDV
Ga0190271_1126227513300018481SoilMVGYALKPIGHIAAWLVWHATRVSLLEDLDSPDPPS
Ga0173481_1006555023300019356SoilVVGTALKPFGHLAAWIVWHAARVSLLDDLKRPSPPHAG
Ga0173481_1011149823300019356SoilMALRPLSHLTAWIVWHAARVSLLEDLESPKPPRNA
Ga0173481_1021826113300019356SoilRSMVGMALRPISHLTAWIVWHAARVSLLDDLDAPSPPRNA
Ga0173479_1017052213300019362SoilMVGMALRPLSHLTAWIVWHAARVSLLEDLDSPKPPRNA
Ga0190264_1100954123300019377SoilMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPHPG
Ga0190267_1094044923300019767SoilMVETALRPVSHIAAWLMWHCTRVSLLEYLERPRPPAP
Ga0193738_106032323300020020SoilMVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPKNA
Ga0196959_1005329823300021184SoilMALRPISHLTAWIVWHAARVSLLEDLDRPRPPKNA
Ga0222622_1019047833300022756Groundwater SedimentMVETALRPLSHLAAWLMWHCMRVSLLEDLERPRPPAP
Ga0222622_1036932723300022756Groundwater SedimentMATAFRPIGHIAAWIVWHAMRVSLLDDLERPEPPHPS
Ga0210076_104576223300025567Natural And Restored WetlandsPDMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPRAA
Ga0210143_100823423300025792Natural And Restored WetlandsMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPRAA
Ga0207710_1046819423300025900Switchgrass RhizosphereMVGMALRPISHLTAWIVWHATRVSLLEDLESPKPPPNA
Ga0207645_1009132343300025907Miscanthus RhizosphereMVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPQNA
Ga0207649_1122102313300025920Corn RhizosphereMATAFRPIGHIAAWIVWHAMRVSLLDDLERPAPPG
Ga0207709_1101957423300025935Miscanthus RhizosphereMNTALRPFGHLAAWILWHTMRVSVLDDLERPQPPHRG
Ga0207640_1047568423300025981Corn RhizosphereMALRPISHLTAWIVWHAARVSLLDDLDSPKPPRNA
Ga0207639_1074040133300026041Corn RhizosphereGGKLRSMAGMALRPIAHLTAWIVWHAARVSLLDDLDAPSPPRNA
Ga0207708_1005768123300026075Corn, Switchgrass And Miscanthus RhizosphereMVGMALRPISHLTAWIVWHAARVSLLDDLDSPKPPRNA
Ga0207675_10171886933300026118Switchgrass RhizosphereMALRPLSHLTAWIVWHAARVSLLDDLDNPKPPQSA
Ga0209387_118353523300027639Agricultural SoilMVGMALRPISHLTAWIVWHAARVSLLEDLDSPRPPQNA
Ga0209574_10000242173300027809AgaveMATAFRPIGHIAAWIVWHATRVSLLDDLERPQPPHPG
Ga0209486_1067670923300027886Agricultural SoilMGTALRPISHLTAWLVWHAMRVSLLDDLDQPAPPHDA
Ga0207428_1001630033300027907Populus RhizosphereMVGMALRPLSHLTAWIVWHAARVSLLEDLDSPKPPPGA
Ga0209382_1153600213300027909Populus RhizosphereVVGIALKPFGHIAAWIVWHAARVSLKDDLERPSPPHAA
Ga0247705_100378133300028004SoilMVTMALRATGHLTAWLVWHSSRVSLLEDLDEPQPPAAA
Ga0247708_100445933300028005SoilMVTLALRPIGHLAAWLVWHSTRISLLDDLDSPRPPDAG
Ga0247708_103167113300028005SoilYGGRMVSTALRPIGHLAAWLVWQSSRISLLGELDSPRPPGAD
Ga0247718_105365513300028007SoilMVSTALRPIGHLAAWLVWQSSRISLLGELDSPRPPGAD
Ga0247828_1101272313300028587SoilMATAFRPIGHIAAWIVWHAVRVSLLDDLDRPQPPQHG
Ga0247818_1075492823300028589SoilMALRPLSHLTAWIVWHAARVSLLDDLDNPKPPQSS
Ga0307276_1006476323300028705SoilMATALRPIGHIAAWLVWHAMRVSLLDDLDRPAPPG
Ga0307298_1010223223300028717SoilMVGLALRPISHLTAWIVWHAARVSLLEDLESPKPPRNA
Ga0307319_1018239423300028722SoilMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPQAG
Ga0307319_1032123823300028722SoilMVGVALRPISHLTAWIVWHAARVSLLDDLERPRPPQNA
Ga0307297_1001637733300028754SoilMGTALRPIGHIAAWIVWHAMRVSLLDDLDRPRPPAS
Ga0307287_1022833523300028796SoilMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPG
Ga0307287_1039340323300028796SoilGTFDSMVGLALRPISHLTAWIVWHAARVSLLEDLESPKPPRNA
Ga0307289_1015488723300028875SoilSVERWGTFDSMVGLALRPISHLTAWIVWHAARVSLLEDLESPKPPRNA
Ga0307289_1047913523300028875SoilMVGMALRPLSHLTAWIVWHAARVSLLEDLDSPKPPRSA
Ga0307278_1025038813300028878SoilMVGLALRPISHLTAWIVWHAARVSLLDDLDSPKPP
Ga0308204_1023891013300031092SoilVGMALRPLSHLTAWIVWHAARVSLLEDLESPKPPQNA
Ga0310837_10223043300031161Plant BiomassMVTWALKPLGHLAAWLLWHTSRISVLEDLDSPRPPASE
Ga0299914_1001566873300031228SoilMANALRPIGHLAAWIVWRSTGVSLLDDLERPQPPGG
Ga0299913_1000453643300031229SoilMGTALRPISHLTAWLVWHAMRVSLLDDLEQPRPPHSA
Ga0299913_1005510033300031229SoilVVIFRPIGHITAWLVWHSLRVSLLDDLDKPEPPAAA
Ga0307408_10034046223300031548RhizosphereMATALRPIGHIAAWIVWHAMRVSLLDDLERPQPPEAG
Ga0307405_1005236543300031731RhizosphereMATAFRPIGHIAAWIVWHAMRVSLLDDLERPQPPEAG
Ga0307405_1192323313300031731RhizosphereMVGLALRPISHLTAWIVWHAARVSLLEDLDSPKPPQNA
Ga0307410_1058681013300031852RhizosphereMVGTALKPLGHLAAWIVWHAARVSLLHDLERPSPPRAG
Ga0308175_10036532223300031938SoilMATALRPFGHIAAWIVWHAVRVSLLDDLDRPAPPG
Ga0307409_10008247523300031995RhizosphereMALRPISHLTAWIVWHAARVSLLEDLDSPRPPQNA
Ga0307409_10293721323300031995RhizosphereMATALRPIGHIAAWIVWHAMRVSLLDDLDRPAPPG
Ga0307416_10347416213300032002RhizospherePMVGMALRPISHLTAWIVWHAARVSLLEDLDSPRPPQNA
Ga0307411_1229409423300032005RhizosphereMATAFRPIGHIAAWIVWHAMRVSLLDDLDRPQPPQ
Ga0268251_1004309533300032159AgaveMIAAALRPIGHFAAWLLWHTARVSLLSDLERPRPPHAR
Ga0247829_1036550813300033550SoilGRFGGMVGMALRPLSHLTAWIVWHAARVSLLDDLDNPKPPQSA
Ga0247829_1147989123300033550SoilMATAFRPIGHIAAWIVWHAIRVSLLDDLERPQPPG
Ga0247830_1100547413300033551SoilMALRPLSHLTAWIVWHAARVSLLEDLESPKPPQNA
Ga0334962_001758_1025_11683300034144Sub-Biocrust SoilMYVGLQDSVMIGTALRPISHVAAWIVWHSMKVSLLDDLDAPRPPGEA
Ga0334913_031780_357_4823300034172Sub-Biocrust SoilMVNVATTALRPIGHVAAWLVWHSLRVSLLEDLDSPRPPQAS
Ga0334913_073863_106_2283300034172Sub-Biocrust SoilMVGNALRATSHLAAWLVWTSMRVSLFDDLDAPQPPLRQQG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.