Basic Information | |
---|---|
Family ID | F022812 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 212 |
Average Sequence Length | 45 residues |
Representative Sequence | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRDFCLGNSL |
Number of Associated Samples | 54 |
Number of Associated Scaffolds | 212 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 53.30 % |
% of genes near scaffold ends (potentially truncated) | 64.15 % |
% of genes from short scaffolds (< 2000 bps) | 67.92 % |
Associated GOLD sequencing projects | 46 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.717 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface (49.057 % of family members) |
Environment Ontology (ENVO) | Unclassified (56.604 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (54.717 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 212 Family Scaffolds |
---|---|---|
PF00149 | Metallophos | 1.42 |
PF00155 | Aminotran_1_2 | 1.42 |
PF10343 | Q_salvage | 1.42 |
PF01850 | PIN | 1.42 |
PF00436 | SSB | 1.42 |
PF02142 | MGS | 1.42 |
PF12728 | HTH_17 | 1.42 |
PF00202 | Aminotran_3 | 1.42 |
PF02091 | tRNA-synt_2e | 0.94 |
PF02518 | HATPase_c | 0.94 |
PF09339 | HTH_IclR | 0.94 |
PF00291 | PALP | 0.94 |
PF01926 | MMR_HSR1 | 0.94 |
PF01128 | IspD | 0.94 |
PF00406 | ADK | 0.94 |
PF12838 | Fer4_7 | 0.94 |
PF00072 | Response_reg | 0.94 |
PF05362 | Lon_C | 0.94 |
PF02527 | GidB | 0.94 |
PF04290 | DctQ | 0.94 |
PF01595 | CNNM | 0.94 |
PF07883 | Cupin_2 | 0.94 |
PF13185 | GAF_2 | 0.94 |
PF02219 | MTHFR | 0.94 |
PF13482 | RNase_H_2 | 0.94 |
PF01261 | AP_endonuc_2 | 0.94 |
PF03966 | Trm112p | 0.94 |
PF14332 | DUF4388 | 0.47 |
PF00873 | ACR_tran | 0.47 |
PF01384 | PHO4 | 0.47 |
PF14691 | Fer4_20 | 0.47 |
PF07900 | DUF1670 | 0.47 |
PF13578 | Methyltransf_24 | 0.47 |
PF05258 | DciA | 0.47 |
PF09754 | PAC2 | 0.47 |
PF01494 | FAD_binding_3 | 0.47 |
PF13735 | tRNA_NucTran2_2 | 0.47 |
PF08668 | HDOD | 0.47 |
PF00005 | ABC_tran | 0.47 |
PF02223 | Thymidylate_kin | 0.47 |
PF07521 | RMMBL | 0.47 |
PF02310 | B12-binding | 0.47 |
PF02629 | CoA_binding | 0.47 |
PF14248 | DUF4345 | 0.47 |
PF00698 | Acyl_transf_1 | 0.47 |
PF00709 | Adenylsucc_synt | 0.47 |
PF03683 | UPF0175 | 0.47 |
PF00085 | Thioredoxin | 0.47 |
PF13282 | DUF4070 | 0.47 |
PF00561 | Abhydrolase_1 | 0.47 |
PF03320 | FBPase_glpX | 0.47 |
PF01121 | CoaE | 0.47 |
PF13847 | Methyltransf_31 | 0.47 |
PF04055 | Radical_SAM | 0.47 |
PF00491 | Arginase | 0.47 |
PF01326 | PPDK_N | 0.47 |
PF00027 | cNMP_binding | 0.47 |
PF07238 | PilZ | 0.47 |
PF00271 | Helicase_C | 0.47 |
PF01702 | TGT | 0.47 |
PF09837 | DUF2064 | 0.47 |
PF02405 | MlaE | 0.47 |
PF03241 | HpaB | 0.47 |
PF04320 | YggL_50S_bp | 0.47 |
PF00574 | CLP_protease | 0.47 |
PF13533 | Biotin_lipoyl_2 | 0.47 |
PF08352 | oligo_HPY | 0.47 |
PF03547 | Mem_trans | 0.47 |
PF02416 | TatA_B_E | 0.47 |
PF01568 | Molydop_binding | 0.47 |
PF13544 | Obsolete Pfam Family | 0.47 |
PF05154 | TM2 | 0.47 |
PF02867 | Ribonuc_red_lgC | 0.47 |
PF02653 | BPD_transp_2 | 0.47 |
PF00231 | ATP-synt | 0.47 |
PF13432 | TPR_16 | 0.47 |
PF01177 | Asp_Glu_race | 0.47 |
PF02737 | 3HCDH_N | 0.47 |
PF00583 | Acetyltransf_1 | 0.47 |
PF08546 | ApbA_C | 0.47 |
PF12694 | cpYpsA | 0.47 |
PF09190 | DALR_2 | 0.47 |
PF16277 | DUF4926 | 0.47 |
PF16327 | CcmF_C | 0.47 |
PF02880 | PGM_PMM_III | 0.47 |
PF02954 | HTH_8 | 0.47 |
PF12727 | PBP_like | 0.47 |
PF13099 | DUF3944 | 0.47 |
PF04127 | DFP | 0.47 |
PF13424 | TPR_12 | 0.47 |
PF13450 | NAD_binding_8 | 0.47 |
PF02357 | NusG | 0.47 |
PF00679 | EFG_C | 0.47 |
PF07690 | MFS_1 | 0.47 |
PF01137 | RTC | 0.47 |
PF03773 | ArsP_1 | 0.47 |
PF01476 | LysM | 0.47 |
PF00294 | PfkB | 0.47 |
PF03950 | tRNA-synt_1c_C | 0.47 |
PF02812 | ELFV_dehydrog_N | 0.47 |
PF05635 | 23S_rRNA_IVP | 0.47 |
PF01106 | NifU | 0.47 |
PF04338 | DUF481 | 0.47 |
PF01035 | DNA_binding_1 | 0.47 |
PF00793 | DAHP_synth_1 | 0.47 |
PF04879 | Molybdop_Fe4S4 | 0.47 |
PF02472 | ExbD | 0.47 |
PF07650 | KH_2 | 0.47 |
PF01966 | HD | 0.47 |
PF13247 | Fer4_11 | 0.47 |
PF01435 | Peptidase_M48 | 0.47 |
PF00266 | Aminotran_5 | 0.47 |
PF00830 | Ribosomal_L28 | 0.47 |
PF13581 | HATPase_c_2 | 0.47 |
PF10049 | DUF2283 | 0.47 |
PF06574 | FAD_syn | 0.47 |
PF13452 | MaoC_dehydrat_N | 0.47 |
PF04432 | FrhB_FdhB_C | 0.47 |
PF00701 | DHDPS | 0.47 |
PF01709 | Transcrip_reg | 0.47 |
PF00781 | DAGK_cat | 0.47 |
PF02146 | SIR2 | 0.47 |
PF05157 | T2SSE_N | 0.47 |
PF01875 | Memo | 0.47 |
PF04545 | Sigma70_r4 | 0.47 |
PF01257 | 2Fe-2S_thioredx | 0.47 |
PF01039 | Carboxyl_trans | 0.47 |
PF13083 | KH_4 | 0.47 |
PF01230 | HIT | 0.47 |
PF00347 | Ribosomal_L6 | 0.47 |
COG ID | Name | Functional Category | % Frequency in 212 Family Scaffolds |
---|---|---|---|
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 1.42 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 1.42 |
COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
COG0357 | 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B) | Translation, ribosomal structure and biogenesis [J] | 0.94 |
COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.94 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.94 |
COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 0.94 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 0.94 |
COG0752 | Glycyl-tRNA synthetase, alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.94 |
COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 0.94 |
COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 0.94 |
COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 0.94 |
COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 0.94 |
COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 0.94 |
COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.47 |
COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.47 |
COG0097 | Ribosomal protein L6P/L9E | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 0.47 |
COG0125 | Thymidylate kinase | Nucleotide transport and metabolism [F] | 0.47 |
COG0196 | FAD synthase | Coenzyme transport and metabolism [H] | 0.47 |
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.47 |
COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG0224 | FoF1-type ATP synthase, gamma subunit | Energy production and conversion [C] | 0.47 |
COG0227 | Ribosomal protein L28 | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.47 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.47 |
COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 0.47 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.47 |
COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.47 |
COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.47 |
COG0343 | Queuine/archaeosine tRNA-ribosyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.47 |
COG0430 | RNA 3'-terminal phosphate cyclase | RNA processing and modification [A] | 0.47 |
COG0452 | Phosphopantothenoylcysteine synthetase/decarboxylase CoaBC | Coenzyme transport and metabolism [H] | 0.47 |
COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.47 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.47 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.47 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.47 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
COG0679 | Predicted permease, AEC (auxin efflux carrier) family | General function prediction only [R] | 0.47 |
COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
COG0701 | Uncharacterized membrane protein YraQ, UPF0718 family | Function unknown [S] | 0.47 |
COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.47 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.47 |
COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.47 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
COG1035 | Coenzyme F420-reducing hydrogenase, beta subunit | Energy production and conversion [C] | 0.47 |
COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.47 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.47 |
COG1355 | Predicted class III extradiol dioxygenase, MEMO1 family | General function prediction only [R] | 0.47 |
COG1494 | Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related protein | Carbohydrate transport and metabolism [G] | 0.47 |
COG1549 | Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domains | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.47 |
COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.47 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.47 |
COG1905 | NADH:ubiquinone oxidoreductase 24 kD subunit (chain E) | Energy production and conversion [C] | 0.47 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.47 |
COG2314 | Uncharacterized membrane protein YozV, TM2 domain, contains pTyr | General function prediction only [R] | 0.47 |
COG2368 | Aromatic ring hydroxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.47 |
COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.47 |
COG3137 | Putative salt-induced outer membrane protein YdiY | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
COG3171 | Uncharacterized conserved protein YggL, DUF469 family | Function unknown [S] | 0.47 |
COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.47 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.47 |
COG5512 | Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives) | General function prediction only [R] | 0.47 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.72 % |
Unclassified | root | N/A | 20.28 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001751|JGI2172J19969_10145232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium DG_8 | 665 | Open in IMG/M |
3300001751|JGI2172J19969_10194782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
3300001782|WOR52_10016344 | All Organisms → cellular organisms → Bacteria | 14121 | Open in IMG/M |
3300001854|JGI24422J19971_10213535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 828 | Open in IMG/M |
3300001854|JGI24422J19971_10316101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 617 | Open in IMG/M |
3300002053|SMTZ23_10060499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 6619 | Open in IMG/M |
3300003142|Ga0052242_1019332 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300003144|Ga0052244_1011339 | Not Available | 822 | Open in IMG/M |
3300005613|Ga0074649_1018978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4038 | Open in IMG/M |
3300005613|Ga0074649_1040250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2173 | Open in IMG/M |
3300005613|Ga0074649_1048882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1857 | Open in IMG/M |
3300005613|Ga0074649_1055157 | Not Available | 1689 | Open in IMG/M |
3300005613|Ga0074649_1059361 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
3300005613|Ga0074649_1086005 | Not Available | 1186 | Open in IMG/M |
3300005613|Ga0074649_1146140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 771 | Open in IMG/M |
3300005613|Ga0074649_1158531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 720 | Open in IMG/M |
3300005613|Ga0074649_1239738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
3300005782|Ga0079367_1065347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 1524 | Open in IMG/M |
3300005782|Ga0079367_1078511 | Not Available | 1364 | Open in IMG/M |
3300005782|Ga0079367_1100462 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300005782|Ga0079367_1185700 | Not Available | 810 | Open in IMG/M |
3300008516|Ga0111033_1020367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3559 | Open in IMG/M |
3300008516|Ga0111033_1022948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 1955 | Open in IMG/M |
3300008517|Ga0111034_1020049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1125 | Open in IMG/M |
3300008517|Ga0111034_1063119 | Not Available | 1191 | Open in IMG/M |
3300008517|Ga0111034_1085900 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
3300008517|Ga0111034_1111111 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
3300008517|Ga0111034_1113322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1349 | Open in IMG/M |
3300008517|Ga0111034_1160942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3156 | Open in IMG/M |
3300008517|Ga0111034_1176279 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
3300008517|Ga0111034_1182674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1308 | Open in IMG/M |
3300008517|Ga0111034_1214527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4135 | Open in IMG/M |
3300008517|Ga0111034_1255297 | Not Available | 1093 | Open in IMG/M |
3300008517|Ga0111034_1278437 | Not Available | 2029 | Open in IMG/M |
3300008517|Ga0111034_1298492 | Not Available | 1197 | Open in IMG/M |
3300009034|Ga0115863_1205141 | All Organisms → cellular organisms → Bacteria | 2372 | Open in IMG/M |
3300009034|Ga0115863_1457229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1469 | Open in IMG/M |
3300009034|Ga0115863_1463718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1456 | Open in IMG/M |
3300009034|Ga0115863_1509552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1375 | Open in IMG/M |
3300009034|Ga0115863_1584909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1265 | Open in IMG/M |
3300009034|Ga0115863_1642145 | Not Available | 1196 | Open in IMG/M |
3300009034|Ga0115863_1642833 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
3300009034|Ga0115863_1762930 | Not Available | 1079 | Open in IMG/M |
3300009034|Ga0115863_1782538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1062 | Open in IMG/M |
3300009034|Ga0115863_1851079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1011 | Open in IMG/M |
3300009105|Ga0117905_1021229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae | 4445 | Open in IMG/M |
3300009135|Ga0118736_10002631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 4134 | Open in IMG/M |
3300009135|Ga0118736_10009891 | Not Available | 2106 | Open in IMG/M |
3300009135|Ga0118736_10019321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1557 | Open in IMG/M |
3300009135|Ga0118736_10024619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1402 | Open in IMG/M |
3300009135|Ga0118736_10043044 | Not Available | 1109 | Open in IMG/M |
3300009136|Ga0118735_10002928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 5873 | Open in IMG/M |
3300009136|Ga0118735_10005749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4157 | Open in IMG/M |
3300009136|Ga0118735_10183430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 681 | Open in IMG/M |
3300009150|Ga0114921_10013165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4555 | Open in IMG/M |
3300009150|Ga0114921_10028716 | All Organisms → cellular organisms → Bacteria | 3300 | Open in IMG/M |
3300009150|Ga0114921_10032284 | All Organisms → cellular organisms → Bacteria | 3141 | Open in IMG/M |
3300009150|Ga0114921_10042679 | All Organisms → cellular organisms → Bacteria | 2797 | Open in IMG/M |
3300009150|Ga0114921_10046143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2704 | Open in IMG/M |
3300009150|Ga0114921_10059161 | Not Available | 2429 | Open in IMG/M |
3300009150|Ga0114921_10208070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1368 | Open in IMG/M |
3300009150|Ga0114921_10352186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1059 | Open in IMG/M |
3300009150|Ga0114921_11242023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
3300009488|Ga0114925_10125522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum alkenivorans | 1649 | Open in IMG/M |
3300009488|Ga0114925_10140094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1566 | Open in IMG/M |
3300009488|Ga0114925_10259195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_47_9 | 1170 | Open in IMG/M |
3300009488|Ga0114925_10368915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 987 | Open in IMG/M |
3300009488|Ga0114925_10593735 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300009488|Ga0114925_10854762 | Not Available | 656 | Open in IMG/M |
3300009488|Ga0114925_11002445 | Not Available | 607 | Open in IMG/M |
3300009488|Ga0114925_11170550 | Not Available | 564 | Open in IMG/M |
3300009488|Ga0114925_11201275 | Not Available | 557 | Open in IMG/M |
3300009488|Ga0114925_11405609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
3300009499|Ga0114930_10008128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 8176 | Open in IMG/M |
3300009499|Ga0114930_10012804 | All Organisms → cellular organisms → Bacteria | 6148 | Open in IMG/M |
3300009499|Ga0114930_10047812 | Not Available | 2643 | Open in IMG/M |
3300009499|Ga0114930_10085442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1794 | Open in IMG/M |
3300009499|Ga0114930_10106493 | Not Available | 1550 | Open in IMG/M |
3300009499|Ga0114930_10140334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium → environmental samples → uncultured Desulfobacterium sp. | 1290 | Open in IMG/M |
3300009499|Ga0114930_10159324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1185 | Open in IMG/M |
3300009499|Ga0114930_10187719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1059 | Open in IMG/M |
3300009499|Ga0114930_10214642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium DG_8 | 967 | Open in IMG/M |
3300009499|Ga0114930_10264006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 841 | Open in IMG/M |
3300009499|Ga0114930_10301197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 769 | Open in IMG/M |
3300009499|Ga0114930_10307439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 758 | Open in IMG/M |
3300009499|Ga0114930_10395735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 640 | Open in IMG/M |
3300009499|Ga0114930_10450072 | Not Available | 588 | Open in IMG/M |
3300009528|Ga0114920_10007258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5734 | Open in IMG/M |
3300009528|Ga0114920_10007903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 5532 | Open in IMG/M |
3300009528|Ga0114920_10018450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3893 | Open in IMG/M |
3300009528|Ga0114920_10025375 | All Organisms → cellular organisms → Bacteria | 3394 | Open in IMG/M |
3300009528|Ga0114920_10049122 | Not Available | 2546 | Open in IMG/M |
3300009528|Ga0114920_10089947 | Not Available | 1942 | Open in IMG/M |
3300009528|Ga0114920_10147099 | Not Available | 1541 | Open in IMG/M |
3300009528|Ga0114920_10789790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
3300009529|Ga0114919_10002247 | All Organisms → cellular organisms → Bacteria | 15598 | Open in IMG/M |
3300009529|Ga0114919_10003760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 12190 | Open in IMG/M |
3300009529|Ga0114919_10009914 | All Organisms → cellular organisms → Bacteria | 7453 | Open in IMG/M |
3300009529|Ga0114919_10011334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 6958 | Open in IMG/M |
3300009529|Ga0114919_10011794 | All Organisms → cellular organisms → Bacteria | 6802 | Open in IMG/M |
3300009529|Ga0114919_10012756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6512 | Open in IMG/M |
3300009529|Ga0114919_10014273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum | 6133 | Open in IMG/M |
3300009529|Ga0114919_10022401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4797 | Open in IMG/M |
3300009529|Ga0114919_10029534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4126 | Open in IMG/M |
3300009529|Ga0114919_10039347 | All Organisms → cellular organisms → Bacteria | 3532 | Open in IMG/M |
3300009529|Ga0114919_10041611 | All Organisms → cellular organisms → Bacteria | 3426 | Open in IMG/M |
3300009529|Ga0114919_10075301 | All Organisms → cellular organisms → Bacteria | 2469 | Open in IMG/M |
3300009529|Ga0114919_10113620 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
3300009529|Ga0114919_10366815 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300010332|Ga0116200_10247837 | Not Available | 883 | Open in IMG/M |
3300010332|Ga0116200_10272471 | Not Available | 833 | Open in IMG/M |
3300011118|Ga0114922_10014233 | Not Available | 7193 | Open in IMG/M |
3300011118|Ga0114922_10100391 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
3300011118|Ga0114922_10154741 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
3300011118|Ga0114922_10187637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1748 | Open in IMG/M |
3300011118|Ga0114922_10188883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1741 | Open in IMG/M |
3300011118|Ga0114922_10818326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 760 | Open in IMG/M |
3300011118|Ga0114922_10967494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 692 | Open in IMG/M |
3300011118|Ga0114922_10970028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 691 | Open in IMG/M |
3300011118|Ga0114922_11100254 | Not Available | 644 | Open in IMG/M |
3300011118|Ga0114922_11324527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 581 | Open in IMG/M |
3300011118|Ga0114922_11382395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 567 | Open in IMG/M |
3300012152|Ga0137347_1066551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
3300013103|Ga0164318_10002536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 17021 | Open in IMG/M |
3300013103|Ga0164318_10068400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3319 | Open in IMG/M |
3300013117|Ga0171658_1230653 | Not Available | 696 | Open in IMG/M |
3300014903|Ga0164321_10385466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 686 | Open in IMG/M |
3300014911|Ga0180301_10003552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 12178 | Open in IMG/M |
3300014911|Ga0180301_10050764 | Not Available | 2758 | Open in IMG/M |
3300014911|Ga0180301_10158063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1325 | Open in IMG/M |
3300014913|Ga0164310_10014007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4817 | Open in IMG/M |
3300014913|Ga0164310_10023765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3750 | Open in IMG/M |
3300014913|Ga0164310_10139812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1495 | Open in IMG/M |
3300017963|Ga0180437_10065273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Desulfuromonas | 3270 | Open in IMG/M |
3300021469|Ga0190361_1216356 | Not Available | 520 | Open in IMG/M |
3300021513|Ga0190315_1020690 | Not Available | 1868 | Open in IMG/M |
3300022552|Ga0212118_10529558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 620 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10212210 | Not Available | 640 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10521648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10532786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
3300024263|Ga0209978_10000866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12010 | Open in IMG/M |
3300024263|Ga0209978_10001597 | All Organisms → cellular organisms → Bacteria | 9739 | Open in IMG/M |
3300024263|Ga0209978_10077320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1696 | Open in IMG/M |
3300024263|Ga0209978_10102678 | Not Available | 1464 | Open in IMG/M |
3300024263|Ga0209978_10118986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1354 | Open in IMG/M |
3300024263|Ga0209978_10293271 | Not Available | 812 | Open in IMG/M |
3300024263|Ga0209978_10342719 | Not Available | 738 | Open in IMG/M |
3300024263|Ga0209978_10618946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
3300024353|Ga0209979_1055962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1844 | Open in IMG/M |
3300024353|Ga0209979_1123896 | Not Available | 1011 | Open in IMG/M |
3300024353|Ga0209979_1164368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 814 | Open in IMG/M |
3300024353|Ga0209979_1167317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 803 | Open in IMG/M |
3300024353|Ga0209979_1206637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 685 | Open in IMG/M |
3300024353|Ga0209979_1288691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
3300024353|Ga0209979_1290477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 527 | Open in IMG/M |
3300024429|Ga0209991_10000782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 14228 | Open in IMG/M |
3300024429|Ga0209991_10017275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3487 | Open in IMG/M |
3300024429|Ga0209991_10022619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3053 | Open in IMG/M |
3300024429|Ga0209991_10034730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2473 | Open in IMG/M |
3300024429|Ga0209991_10049905 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
3300024429|Ga0209991_10124230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1288 | Open in IMG/M |
3300024429|Ga0209991_10355101 | Not Available | 693 | Open in IMG/M |
3300024432|Ga0209977_10035543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum | 2410 | Open in IMG/M |
3300024432|Ga0209977_10221820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 920 | Open in IMG/M |
3300024432|Ga0209977_10455631 | Not Available | 601 | Open in IMG/M |
3300024433|Ga0209986_10005226 | All Organisms → cellular organisms → Bacteria | 10809 | Open in IMG/M |
3300024433|Ga0209986_10007993 | All Organisms → cellular organisms → Bacteria | 8336 | Open in IMG/M |
3300024433|Ga0209986_10028357 | All Organisms → cellular organisms → Bacteria | 3621 | Open in IMG/M |
3300024433|Ga0209986_10030541 | All Organisms → cellular organisms → Bacteria | 3448 | Open in IMG/M |
3300024433|Ga0209986_10033902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3220 | Open in IMG/M |
3300024433|Ga0209986_10042567 | All Organisms → cellular organisms → Bacteria | 2769 | Open in IMG/M |
3300024433|Ga0209986_10054366 | All Organisms → cellular organisms → Bacteria | 2352 | Open in IMG/M |
3300024433|Ga0209986_10070625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1982 | Open in IMG/M |
3300024433|Ga0209986_10076692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1878 | Open in IMG/M |
3300024433|Ga0209986_10112841 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
3300024433|Ga0209986_10169213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1115 | Open in IMG/M |
3300024433|Ga0209986_10288507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 781 | Open in IMG/M |
3300024433|Ga0209986_10332756 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10064988 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10267551 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia aquarii | 801 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10367688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 685 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10685173 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300027888|Ga0209635_10116997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2185 | Open in IMG/M |
3300027888|Ga0209635_10398819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1070 | Open in IMG/M |
3300027888|Ga0209635_10553547 | Not Available | 868 | Open in IMG/M |
3300027893|Ga0209636_10017415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7313 | Open in IMG/M |
3300027893|Ga0209636_10113504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2591 | Open in IMG/M |
3300027901|Ga0209427_10866920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 631 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10074140 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10198212 | Not Available | 901 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10207558 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300028620|Ga0257139_1022410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1136 | Open in IMG/M |
3300029638|Ga0257144_1031885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 788 | Open in IMG/M |
3300031255|Ga0315554_1294724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
3300031280|Ga0307428_1143011 | Not Available | 605 | Open in IMG/M |
3300031357|Ga0307435_1094085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 700 | Open in IMG/M |
3300031553|Ga0315547_1100103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1005 | Open in IMG/M |
3300031553|Ga0315547_1223710 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300031553|Ga0315547_1275274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
3300031575|Ga0315532_1131857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 750 | Open in IMG/M |
3300031575|Ga0315532_1141424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 710 | Open in IMG/M |
3300031586|Ga0315541_1042013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1901 | Open in IMG/M |
3300031586|Ga0315541_1046154 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
3300031586|Ga0315541_1049943 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
3300031586|Ga0315541_1062373 | Not Available | 1403 | Open in IMG/M |
3300031586|Ga0315541_1095156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1008 | Open in IMG/M |
3300031586|Ga0315541_1123029 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300031586|Ga0315541_1127021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 798 | Open in IMG/M |
3300031586|Ga0315541_1129913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 784 | Open in IMG/M |
3300031586|Ga0315541_1215471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
3300031654|Ga0315549_1080897 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1599 | Open in IMG/M |
3300032029|Ga0315546_1154668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 505 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 49.06% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 8.49% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 8.02% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 4.25% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 4.25% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 4.72% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.72% |
Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 4.72% |
Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 2.36% |
Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 1.42% |
Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 1.42% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.94% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.94% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.94% |
Marine Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment | 0.94% |
Marine Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment | 0.94% |
Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 0.47% |
Hydrothermal Vent Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment | 0.47% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.47% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.47% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001751 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 | Environmental | Open in IMG/M |
3300001782 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_deep_samples | Environmental | Open in IMG/M |
3300001854 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 | Environmental | Open in IMG/M |
3300002053 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZ | Environmental | Open in IMG/M |
3300003142 | Marine sediment microbial communities from deep subseafloor - Sample from 5.1 mbsf | Environmental | Open in IMG/M |
3300003144 | Marine sediment microbial communities from deep subseafloor - Sample from 18.6 mbsf | Environmental | Open in IMG/M |
3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
3300005782 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf, PM3 | Environmental | Open in IMG/M |
3300008516 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf. Combined Assembly of MM3PM3 | Environmental | Open in IMG/M |
3300008517 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4 | Environmental | Open in IMG/M |
3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
3300009105 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
3300009135 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsf | Environmental | Open in IMG/M |
3300009136 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf | Environmental | Open in IMG/M |
3300009150 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG | Environmental | Open in IMG/M |
3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
3300010332 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4571-4 3-6 cm metaG | Environmental | Open in IMG/M |
3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
3300012152 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2 | Environmental | Open in IMG/M |
3300013103 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cm | Environmental | Open in IMG/M |
3300013117 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 900m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
3300014911 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay16, Core 4569-2, 12-15 cm | Environmental | Open in IMG/M |
3300014913 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cm | Environmental | Open in IMG/M |
3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
3300021469 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-4-5_MG | Environmental | Open in IMG/M |
3300021513 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-11-0-1_MG | Environmental | Open in IMG/M |
3300022552 | Guaymas_combined assembly | Environmental | Open in IMG/M |
3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
3300024263 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024353 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024429 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024432 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
3300028620 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_80m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029638 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_80m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031255 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-70 | Environmental | Open in IMG/M |
3300031280 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-240 | Environmental | Open in IMG/M |
3300031357 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-70 | Environmental | Open in IMG/M |
3300031553 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-240 | Environmental | Open in IMG/M |
3300031575 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment WE1603-70 | Environmental | Open in IMG/M |
3300031586 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-190 | Environmental | Open in IMG/M |
3300031654 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-200 | Environmental | Open in IMG/M |
3300032029 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-170 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI2172J19969_101452322 | 3300001751 | Marine Sediment | LLQTISKLALQAQTVEIAYLPLRQDLLAKNVLKTLKGIFIWATAR* |
JGI2172J19969_101947822 | 3300001751 | Marine Sediment | LLQATSKLALRAQTVEVADLPLRQDLSAKNVLMTAQRNFCLGNTLFKIGKKQ* |
WOR52_1001634416 | 3300001782 | Marine Sediment | MSKLAFRAQTVDIAYLPLRQDFFAKNVLMTAQRDFRLGNSLL |
JGI24422J19971_102135353 | 3300001854 | Marine Sediment | MSKLAFRAQTVDIAYLPLHQDLLAKNVLMTAQRNFR |
JGI24422J19971_103161012 | 3300001854 | Marine Sediment | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRDFPLGNSLLSPDLFN* |
SMTZ23_100604991 | 3300002053 | Marine Sediment | AQTVEVADLPLRQDLSAKNVLMTAQRNFCLGNTLSTIDQ* |
Ga0052242_10193322 | 3300003142 | Marine Sediment | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFRLGNSLFDVTLQSWCFSIR |
Ga0052244_10113391 | 3300003144 | Marine Sediment | QAMSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFRLGNSPSTLKKR* |
Ga0074649_10189784 | 3300005613 | Saline Water And Sediment | MSKLAFRAQTVDIAYLSLRQDLLAKNVLMTAQRDFGLGNSL* |
Ga0074649_10402504 | 3300005613 | Saline Water And Sediment | GSLQAMSKLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRNFRLGKQPVDI* |
Ga0074649_10488822 | 3300005613 | Saline Water And Sediment | MSKLAFRAQTVDIAYVAVRQDLLAKTVLMTAQRDFSLGNNLSMGYPVFCM* |
Ga0074649_10551572 | 3300005613 | Saline Water And Sediment | MSKLALWAQTVAIAYLPLRQDFLAKNVLMTAQRDLVLGNSLKKPDMWLI* |
Ga0074649_10593612 | 3300005613 | Saline Water And Sediment | MSKLTFRAQTVDIAYLPLRQDLLAKNILMTAQRNFRLGNSLF* |
Ga0074649_10860051 | 3300005613 | Saline Water And Sediment | EAMSKLAFRAQTVDIAYLPLRQDFLAKNVLMSAQRYFRLGNSPNSLER* |
Ga0074649_11461401 | 3300005613 | Saline Water And Sediment | MPKLAFRAQPVDIAYLPLRQDLLATNVLMTAQKDFRLGNSLMQSDPSVSQWRYL* |
Ga0074649_11585312 | 3300005613 | Saline Water And Sediment | AFRAQTVDIAYLPLRQDLFPKNVLMTAQRDFRLGNNLLNMKF* |
Ga0074649_12397381 | 3300005613 | Saline Water And Sediment | MSKLAFRAQTVDIAYLALRQDFLAKNGLMTAQRDVGLGNSL* |
Ga0079367_10653473 | 3300005782 | Marine Sediment | MSKLAFRAQTVDIAYLPLRQDFLAKSVLMTAQRDFRLGNSLSKG* |
Ga0079367_10785112 | 3300005782 | Marine Sediment | AMSKLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRDYGLGNSLLRVGPPGSVPLKVL* |
Ga0079367_11004621 | 3300005782 | Marine Sediment | MSKLAFRAQTVDIACLPLRQDLFAKNVLMTAQRDFRLGNS |
Ga0079367_11857001 | 3300005782 | Marine Sediment | QAMSKLAFRAQTVDIAYLPFRQDLLPKTFLRFAQGQV* |
Ga0111033_10203673 | 3300008516 | Marine Sediment | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFR |
Ga0111033_10229483 | 3300008516 | Marine Sediment | LQAMSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRNFRLGNSLSKG* |
Ga0111034_10200491 | 3300008517 | Marine Sediment | MSKLALGAQTVDIAYLPLRQDLFAKNVLMTAQRDFRLGNSL |
Ga0111034_10631191 | 3300008517 | Marine Sediment | KLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRDFRLGNSLLICEPLIPPPTRTFL* |
Ga0111034_10859001 | 3300008517 | Marine Sediment | MSKLAFRAQTVDIAYLPLRQDLFEKNILMTVQWDFGKSLLTGDMIHWY* |
Ga0111034_11111111 | 3300008517 | Marine Sediment | KLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFRLGNSL* |
Ga0111034_11133221 | 3300008517 | Marine Sediment | LQAMSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFRLGNSP* |
Ga0111034_11609421 | 3300008517 | Marine Sediment | MSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFR |
Ga0111034_11762794 | 3300008517 | Marine Sediment | MSKLAFRAQTVDIACLPLRQDLFAKNVLMTVQRDFGKSLLTGDMIHWY* |
Ga0111034_11826741 | 3300008517 | Marine Sediment | MSKLAFRAQTVDIAYLPLRQDLLAKNLLMTAQRDLR |
Ga0111034_12145272 | 3300008517 | Marine Sediment | MSKLAFRAQTVDIAYLALRQDLLAKNVLMTAQRDFGNSIGTKI* |
Ga0111034_12552972 | 3300008517 | Marine Sediment | MSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDL |
Ga0111034_12784371 | 3300008517 | Marine Sediment | MSKLAFRAQTVAIAYLPLRQDLFAKNVLMAAQRDFRLGNNPSKCDS |
Ga0111034_12984922 | 3300008517 | Marine Sediment | MSKLAFRAQTVDIAYLSLRQDLLAKNVLMTAQRDFGLGNSLLTFESVGY* |
Ga0115863_12051415 | 3300009034 | Sediment, Intertidal | MSKLAFRAQTIDIAYLPLRQDLFAKNVLMTAQRDFGNSLLTADPPQLNP* |
Ga0115863_14572292 | 3300009034 | Sediment, Intertidal | MSKLAFRAQTVDIAYLPLCQDLFAKNVLMTAQRDFRLGNSPLTADT* |
Ga0115863_14637181 | 3300009034 | Sediment, Intertidal | MSKLAFRAQTVDIAYLPFRQDLLAKNVLMTAKRNFH |
Ga0115863_15095522 | 3300009034 | Sediment, Intertidal | MSKLAFRAQTVDIAYLPLRQDFLAKTVLMTAQRDFGLGNSP* |
Ga0115863_15849091 | 3300009034 | Sediment, Intertidal | LQAMSKLAFRAQTVDIAYLPLRQDFLAKTVLMTAQRDFGLGNSP* |
Ga0115863_16421451 | 3300009034 | Sediment, Intertidal | QAMSKLTLRAQTVDIAYLPLRQDLFAKNVLMTAQRNFRLDNSP* |
Ga0115863_16428332 | 3300009034 | Sediment, Intertidal | MSKLAFRAQTVDIAYLPLRQDLLAKTVLMTVQMDFCLGNSLKRIEIT* |
Ga0115863_17629301 | 3300009034 | Sediment, Intertidal | QAMSKLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRDFRLSKSPNSLDT* |
Ga0115863_17825382 | 3300009034 | Sediment, Intertidal | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRDYGLGNSLFKGEGKLAYG* |
Ga0115863_18510792 | 3300009034 | Sediment, Intertidal | MSKLAFRAQRVDIAYLPLRQDLLAKNVLMTAQMDFRLGNSLLNIDDLSIKGCF* |
Ga0117905_10212295 | 3300009105 | Marine | LLQAISKLTLRVQTVEIAYLTLRQDLSAKSAAMTAQKNFH* |
Ga0118736_100026311 | 3300009135 | Marine Sediment | QTVDIAYLPLRQDLFAKNVLMTAQRDFRLGNSLF* |
Ga0118736_100098911 | 3300009135 | Marine Sediment | LQAMSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFRLGNSPSTLKKR* |
Ga0118736_100193214 | 3300009135 | Marine Sediment | RAQTVDIAYLPLRQDLFAKNVLMTAKSNFRLGNSLLKSNLG* |
Ga0118736_100246192 | 3300009135 | Marine Sediment | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFCNSLLTADPPQLNV* |
Ga0118736_100430443 | 3300009135 | Marine Sediment | TVDIAYLPLRQDLLAKNVLMTAQRDYGLANSLFKVS* |
Ga0118735_100029286 | 3300009136 | Marine Sediment | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAKSNFRLGNSLLKSNLG* |
Ga0118735_100057495 | 3300009136 | Marine Sediment | RAQTVDIAYLPLRQDLFAKNVLMTAQRNFRLGNSL* |
Ga0118735_101834301 | 3300009136 | Marine Sediment | VDIAYLPLRQDLFAKNVLTTAQRDFRLGNSSYPAL* |
Ga0114921_100131652 | 3300009150 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRDFRLGNSLSTSSLFLVER* |
Ga0114921_100287164 | 3300009150 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDFLAKNVSMTAQRDFRLGNS |
Ga0114921_100322846 | 3300009150 | Deep Subsurface | SKLAFRAQTVDIASLPLRQDLLAKNVLMTAQRDFGLGNSLLRPDPNSKIQAAAE* |
Ga0114921_100426791 | 3300009150 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRDF |
Ga0114921_100461434 | 3300009150 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFRLG |
Ga0114921_100591615 | 3300009150 | Deep Subsurface | LLQAIRKLALWAQTVRIADLPLRQDLLAKNVLMTAQRNFYLGNSLLIGDLWLS* |
Ga0114921_102080701 | 3300009150 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRDFCLG |
Ga0114921_103521862 | 3300009150 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTTQRDLVLGNSLFK* |
Ga0114921_112420232 | 3300009150 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFRLGNSPYPAL* |
Ga0114925_101255223 | 3300009488 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFCLGNSLLNIDDLGIKGCF* |
Ga0114925_101400942 | 3300009488 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDFLAKNVLVTAQRNFRLGNSPSM |
Ga0114925_102591951 | 3300009488 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDFLTKNVLMTAQRNFRLGNSLLIPDTHTLLRE |
Ga0114925_103689152 | 3300009488 | Deep Subsurface | MSKLTLRAQTVDIAYLTLRQDFLAKNVLMTAQRDFGLRNS |
Ga0114925_105937352 | 3300009488 | Deep Subsurface | GSLQAMSKLAFRAQTVDIAYLPLRQDLFAKNVLMTVQRNFCFGNSP* |
Ga0114925_108547621 | 3300009488 | Deep Subsurface | QAMSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFRLGNSPSIVNL* |
Ga0114925_110024451 | 3300009488 | Deep Subsurface | KLAFRAQTVDIAYLPLRQGFFGKNVLMTAQRNFRLGNSPNSLDT* |
Ga0114925_111705501 | 3300009488 | Deep Subsurface | LAFRAQTIDIAYLPLRQDLLAKNVLTTAQRDFRLDNSPSIVNLQ* |
Ga0114925_112012751 | 3300009488 | Deep Subsurface | FRAQTVGIAYLPLRQDFFAKNVLMTAQRNFRLGNSLLN* |
Ga0114925_114056091 | 3300009488 | Deep Subsurface | RAQTVDIAYLPLRQDFLAKNVLMTVQRDFRLGNSPLRYWF* |
Ga0114930_100081285 | 3300009499 | Deep Subsurface | MSKLAFMAQTVDIAYLPFRQDFLAKNVLVTVQKDFHLGNSPLKSNLA* |
Ga0114930_100128042 | 3300009499 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFGLGNSLLKFEP* |
Ga0114930_100478124 | 3300009499 | Deep Subsurface | SKLALRAQTVEIAYLPLRQDLLAKNVLMTAQRNFCLGNNPFTLDLSIF* |
Ga0114930_100854422 | 3300009499 | Deep Subsurface | MSKLGFGAQTVDIAYLSLRQDLLAKNVLMTAQRDFGLGNSLKTFDCYQTAMLIYL* |
Ga0114930_101064931 | 3300009499 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFHLGNSL* |
Ga0114930_101403341 | 3300009499 | Deep Subsurface | AMSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFGLGNSL* |
Ga0114930_101593241 | 3300009499 | Deep Subsurface | AISKLALRAQTVEIAYLPLRQDLLAKNVLMTAQRNFCLGNSLSIP* |
Ga0114930_101877193 | 3300009499 | Deep Subsurface | SKLALRAQTVEIAYLPLRQDLLAKNVLMTAQRNFCLGNNP* |
Ga0114930_102146422 | 3300009499 | Deep Subsurface | SKLALRAQTVEIAYLPLRQDLLAKNVLMTAQRNFCLGNNPSSFDPVNS* |
Ga0114930_102640062 | 3300009499 | Deep Subsurface | MSKLAFRAQIFEIAYLPLRQDLLEKNVLMTAQKDFPLGNNPLR |
Ga0114930_103011972 | 3300009499 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFSKNVLMTAQRDFRLGNSLLKGEGKLAHG* |
Ga0114930_103074391 | 3300009499 | Deep Subsurface | SKLAFRAQTVDIAYLPLRQDLLLENVLMTAQRDFCGQG* |
Ga0114930_103957351 | 3300009499 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTVQRDF |
Ga0114930_104500721 | 3300009499 | Deep Subsurface | MSKLTLRVQTVDIAYLPLRQDLLAKNVLMTAQRDFRLSNSLS |
Ga0114920_100072586 | 3300009528 | Deep Subsurface | MSKLAFRAHTVDIAYLPLHQDFLAKNVLMTAQRDFQLGNSLFVHDDFSKP* |
Ga0114920_100079033 | 3300009528 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQMDFCLGNSLLNIDDLGIKGCF* |
Ga0114920_100184505 | 3300009528 | Deep Subsurface | YLALRAQTADIAYLPLRQDFLAKNVLMTAQRNFRLGNSPVTSDT* |
Ga0114920_100253753 | 3300009528 | Deep Subsurface | MSKLAFGAQTVDIAYLPLRQDFLARNVLMTAKRDFGLGNSLFAFDKSPPC* |
Ga0114920_100491224 | 3300009528 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQMDFRLGNSLWIFEF* |
Ga0114920_100899472 | 3300009528 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFRLGNSL* |
Ga0114920_101470991 | 3300009528 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFRLGNSLLTAYLPQLNV* |
Ga0114920_107897901 | 3300009528 | Deep Subsurface | LQAMSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFRLGNTP* |
Ga0114919_1000224711 | 3300009529 | Deep Subsurface | MSKLTFRAQTVHIAYLPLRQDFLAKKRFDDRSKKFRLGNSLLTRNKMNI* |
Ga0114919_1000376013 | 3300009529 | Deep Subsurface | MSKLAIRAQTVDIAYLPLRQDLLAKNVLTTAQRDFRLGNSLWIFEF* |
Ga0114919_100099142 | 3300009529 | Deep Subsurface | MSKLTLWAQTVDIAYLPLRQDLLAKNVLMTAQRDLGLGNSLLNIKY* |
Ga0114919_100113341 | 3300009529 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFRLGNSLLKVS* |
Ga0114919_100117943 | 3300009529 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFGLGNSLMQSDPSVSQWRYL* |
Ga0114919_100127561 | 3300009529 | Deep Subsurface | SKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFCLGNSLMKLKV* |
Ga0114919_100142734 | 3300009529 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLLEKNVLMTAQMDFCLGNSLLNIDA* |
Ga0114919_100224011 | 3300009529 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQMDFCLGNSLYELDGISWNL* |
Ga0114919_100295341 | 3300009529 | Deep Subsurface | MSKLTFRAQTVDIACLPLGQDLLAKNVLMTAQRDFGLGNNLSRPDTII |
Ga0114919_100393471 | 3300009529 | Deep Subsurface | AMSKLAFRAQTVDIACLPLRQDLLAKNVLMTAQRDFGLGNSLFTFDM* |
Ga0114919_100416114 | 3300009529 | Deep Subsurface | MSKLAFRAQTVDIACLPLRQDLYAKNVLMTAQRDFGLGNNLLISD* |
Ga0114919_100753012 | 3300009529 | Deep Subsurface | AQTVDIAYLPLRQDLLAKNVLMTAQRDFRLGNIPSIG* |
Ga0114919_101136201 | 3300009529 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDLVLGNSLLIFKYSN* |
Ga0114919_103668152 | 3300009529 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMAAQRDFRLGNNPSKCASLVDY* |
Ga0116200_102478371 | 3300010332 | Marine Hydrothermal Vent | MSKLALRAQTVDIADLPLRQDLLAKNVLMTAQRNFCLGSGP |
Ga0116200_102724712 | 3300010332 | Marine Hydrothermal Vent | SKLALRAQTVDIADLPLRQDLLAKNVLMTAQRNFCLGSGPFKPDFVC* |
Ga0114922_100142331 | 3300011118 | Deep Subsurface | ISKLALWAQTVEIANLPLRQDLFAKNVLMTAQRNFCLGNSL* |
Ga0114922_101003911 | 3300011118 | Deep Subsurface | RAQTVDIAYLPLRQDFLAKNVLMTAQRDFRLGNSL* |
Ga0114922_101547413 | 3300011118 | Deep Subsurface | SKLALRAQTVEVADLPLRQDLSAKNVLMTAQRNFCLGNTL* |
Ga0114922_101876371 | 3300011118 | Deep Subsurface | MSKLAFRAQTVDIAYLPLHQDFLAKNVLMTAQRDFRLGNSLS |
Ga0114922_101888833 | 3300011118 | Deep Subsurface | KLAFRAQTVDIACLLLRQDFLAKNVLMTAQGDFALGNSLSCPETSV* |
Ga0114922_108183261 | 3300011118 | Deep Subsurface | MSKLAFRAQTVDIAYLALRQDLLAKNVLMTAQRDFGNSLQTINSFH* |
Ga0114922_109674943 | 3300011118 | Deep Subsurface | RAQTVDIAYLPLRQDFLAKNVLMTSQRDFRLGKCPLEGDIIGNSETG* |
Ga0114922_109700281 | 3300011118 | Deep Subsurface | SLQAMSKLAFRAQTVDIAHLPLRQDLFAKNVLMTAQRDYSLGNSP* |
Ga0114922_111002542 | 3300011118 | Deep Subsurface | GAQTVDIACLPLRQDFLAKNVLVTAQRDLVLGNSL* |
Ga0114922_113245271 | 3300011118 | Deep Subsurface | MSEIAFRAQTVDIAYLPLRQDFLAKNVLMTAQRNFRL |
Ga0114922_113823951 | 3300011118 | Deep Subsurface | MSKLAFRAQTVDIACLPLRQDLLAKVVLMTAQRDLGLGNNL* |
Ga0137347_10665511 | 3300012152 | Soil | GSLQAISKLALRAQTVEIAFLTLRQDLLDKNVLMTAQRNFCLGNSLLI* |
Ga0164318_100025361 | 3300013103 | Marine Sediment | MSKLALRAQAVDIADLPLRQDLLAKNVLMTAQRNF |
Ga0164318_100684003 | 3300013103 | Marine Sediment | MSKLALRAQTVDIADLPLRQDLLAKNVLMTAQRNFCLGNS |
Ga0171658_12306532 | 3300013117 | Marine | LLQAIRKLALRAQTVRIADLPLRQDLLAKNVLMTAQRNLCLGNNLLNIDDR* |
Ga0164321_103854661 | 3300014903 | Marine Sediment | QTVEIAYLPLRQDLLAKNVLMTAQRNFCLGNSLLMI* |
Ga0180301_1000355215 | 3300014911 | Marine Sediment | MSKLALQAQAVDIADLPLRQDLLAKNVLMTAQRNFCLGNGQ* |
Ga0180301_100507644 | 3300014911 | Marine Sediment | MSKLALRAQAVDIADLPLRQDLLAKNVLMTAQRNFCVGNGLIVADPFFINPFSS* |
Ga0180301_101580631 | 3300014911 | Marine Sediment | MSKLALRAQTVDIADFALRQDLLAKNVLMTAQRNFCLGNGPITGD |
Ga0164310_1001400710 | 3300014913 | Marine Sediment | SKLALRAQTVDIADLPLRQDLLAKNVLMTAQRNFCLGNSLLIYYPN* |
Ga0164310_100237651 | 3300014913 | Marine Sediment | MSKLAIWAQTVDIANLPLRQDLLAKNVLMTAQRNFCLATAR* |
Ga0164310_101398122 | 3300014913 | Marine Sediment | MSKLALRAQAVDIADLPLRQDLLAKNVLMTAQRNFCLGNGQ* |
Ga0180437_100652731 | 3300017963 | Hypersaline Lake Sediment | MSKLALRAQTVDITGLPLRQDVLTKNASISAQTDFGL |
Ga0190361_12163561 | 3300021469 | Hydrothermal Vent Microbial Mat | RAQTVDIADLPLRQDLLAKNVLMTAQRNFCLGSGPFKPDFVC |
Ga0190315_10206904 | 3300021513 | Hydrothermal Vent Sediment | MSKLALRAQAVDIADLPLRQDLLAKNVLMTAQRNFCVGNGLIVADPFFI |
Ga0212118_105295581 | 3300022552 | Marine Hydrothermal Vent | MSKLALRAQTVDIADFALRQDLLAKNVLMTAQRNFCLGNGPITGDCKRFKYK |
(restricted) Ga0233411_102122101 | 3300023112 | Seawater | ISKLALRAQTVEIAYLPLRQDLLAKNVLMTTQRDFCLGNSP |
(restricted) Ga0233412_105216482 | 3300023210 | Seawater | KLARRAQTVEIAYLPLRQDLLAQNVLKTAQRNFCLGNNP |
(restricted) Ga0233412_105327862 | 3300023210 | Seawater | KLALRVQTVEIAYLPLRQDLLAQNVLKTAQRNFYLGNNPLSVNP |
Ga0209978_100008665 | 3300024263 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRDFRLGNSLSTSSLFLVER |
Ga0209978_1000159710 | 3300024263 | Deep Subsurface | MSKLAFGAQTVDIAYLPLRQDFLARNVLMTAKRDFGLGNSLFAFDKSPPC |
Ga0209978_100773201 | 3300024263 | Deep Subsurface | MSKLAFRAQTVDIAYLPVRQDLFAKNVLMTAQRNFRLGNSLF |
Ga0209978_101026781 | 3300024263 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRDFR |
Ga0209978_101189862 | 3300024263 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTTQRDLVLGNSLFK |
Ga0209978_102932712 | 3300024263 | Deep Subsurface | KLTLRAQTVDIAYLPLRQDLLTKNVLMTAQRDYGLGNSL |
Ga0209978_103427191 | 3300024263 | Deep Subsurface | VKLCAKLALWAQTVRIADLPLCQDLLAKNVLMTAQRNFYLGNSLLTFNP |
Ga0209978_106189461 | 3300024263 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQMDFCLGNSLYE |
Ga0209979_10559621 | 3300024353 | Deep Subsurface | FRAQTVDIACLPLRQDFLAKNVLMTAQRELVLGNSL |
Ga0209979_11238962 | 3300024353 | Deep Subsurface | MSKLGFGAQTVDIAYLSLRQDLLAKNVLMTAQRDFGLGNSLKTFDCYQTAMLIYL |
Ga0209979_11643681 | 3300024353 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFHLGNSL |
Ga0209979_11673172 | 3300024353 | Deep Subsurface | MSKLAFMAQTVDIAYLPFRQDFLAKNVLVTVQKDFHLGNSPLKSNLA |
Ga0209979_12066371 | 3300024353 | Deep Subsurface | MSKLAFRAQTVDIACLPLRQDFLAKNVLMTAQRDLVL |
Ga0209979_12886911 | 3300024353 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDLGLGNSLMT |
Ga0209979_12904771 | 3300024353 | Deep Subsurface | MSKLAFRAQTVDIAYLPPRQDLFAKNVLMTAQRNFRLGNRLLTTEVPLLV |
Ga0209991_1000078212 | 3300024429 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQMDFRLGNSLWIFEF |
Ga0209991_100172752 | 3300024429 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFRLGNSL |
Ga0209991_100226194 | 3300024429 | Deep Subsurface | MSKLAFRAQTVDITYLPLHQDLLAKNVLMTAQRDFRL |
Ga0209991_100347304 | 3300024429 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDYGLGNSLSTQKER |
Ga0209991_100499053 | 3300024429 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQMDFCLGNSLLNIDDLGIKGCF |
Ga0209991_101242301 | 3300024429 | Deep Subsurface | MSKLAFRAQTVDIACLPLRQDFLAKNVLMTAQRDFGLGNSL |
Ga0209991_103551011 | 3300024429 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFRLGNSLLTAYLPQLNV |
Ga0209977_100355433 | 3300024432 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFCLGNSLLNIDDLGIKGCF |
Ga0209977_102218201 | 3300024432 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRDFCLGNSL |
Ga0209977_104556312 | 3300024432 | Deep Subsurface | GSLQAMSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFGLGNSLLN |
Ga0209986_1000522613 | 3300024433 | Deep Subsurface | RAMSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFGLGNSLMQSDPSVSQWRYL |
Ga0209986_100079935 | 3300024433 | Deep Subsurface | MSKLAFRAQTVDIACLPLRQDLYAKNVLMTAQRDFGLGNNLLISD |
Ga0209986_100283571 | 3300024433 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLLAKNLLMTVQRDFGLGNSLMTSDMLQ |
Ga0209986_100305412 | 3300024433 | Deep Subsurface | MSKLAIRAQTVDIAYLPLRQDLLAKNVLTTAQRDFRLGNSLWIFEF |
Ga0209986_100339024 | 3300024433 | Deep Subsurface | MSKLTLWAQTVDIAYLPLRQDLLAKNVLMTAQRDLGLGNSLLNIKY |
Ga0209986_100425673 | 3300024433 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDLLEKNVLMTAQMDFCLGNSLLNIDA |
Ga0209986_100543662 | 3300024433 | Deep Subsurface | MSKLTFRAQTVHIAYLPLRQDFLAKKRFDDRSKKFRLGNSLLTRNKMNI |
Ga0209986_100706251 | 3300024433 | Deep Subsurface | MSKLAFRAQTVDIAYIPLRQDLLAKNVLMTAQRDFRLGN |
Ga0209986_100766921 | 3300024433 | Deep Subsurface | MSKLTLRAQTVDIAYLPLRQDLFAKNVLMTAQRDFCLGNSPKKLD |
Ga0209986_101128412 | 3300024433 | Deep Subsurface | MSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDLVLGNSLLIFKYSN |
Ga0209986_101692133 | 3300024433 | Deep Subsurface | LRVQTVDIAYLPLRQDLLAKNVLMTAQRDYGLANSLYKVS |
Ga0209986_102885072 | 3300024433 | Deep Subsurface | RAQTVDIACLPLRQDLLAKNVLMTAQRDFGLGNNL |
Ga0209986_103327562 | 3300024433 | Deep Subsurface | LQAMSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFRLGNSLSKLKVQIHPVKSP |
(restricted) Ga0233415_100649882 | 3300027861 | Seawater | VISKLALRAQTVEIAYLPLRQDLLAQNVLKTAQRNFYLGNNPF |
(restricted) Ga0233415_102675512 | 3300027861 | Seawater | QVISKLALRAQTVEIAYLPLRQDLLAQNVLKTAQRNFYLGNNPFILDK |
(restricted) Ga0233415_103676882 | 3300027861 | Seawater | ISKLARRAQTVEIAYLPLHQDLLAQNVLKTAQRNFYLGNNP |
(restricted) Ga0233415_106851731 | 3300027861 | Seawater | LLQAISKLALRVQTVEIAYLPLRQDLLAQNVLKTAQRNFYLG |
Ga0209635_101169975 | 3300027888 | Marine Sediment | AQTVQIAHLPLRQDLLAKNVLMTAQSDSCLGNSLLSHELTNLR |
Ga0209635_103988191 | 3300027888 | Marine Sediment | MSKLALRAQTVDIAYLPLRQDLLAKNVLMTAQRDFRLGNSLLTGNLKLNRYH |
Ga0209635_105535471 | 3300027888 | Marine Sediment | SQTVEIAYLPLRQDLLAKNLLKTAQRNFCLGKSRFYLT |
Ga0209636_100174155 | 3300027893 | Marine Sediment | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRDFPLGNSLLSPDLFN |
Ga0209636_101135042 | 3300027893 | Marine Sediment | LLQATSKLALRAQTVEVADLPLRQDLSAKNVLMTAQRNFCLGNTLFKIGKKQ |
Ga0209427_108669201 | 3300027901 | Marine Sediment | MSKLAFRAQTVDIAYLPLHQDLLAKNVLMTAQRNFRSGNSLL |
(restricted) Ga0233413_100741402 | 3300027996 | Seawater | VISKLALRAQTVEIAYLPLRQDLLAQNVLKTAQRNFYLGN |
(restricted) Ga0233414_101982121 | 3300028045 | Seawater | ISKLALRAQTVEIAYLPLRQDLLAKNVLMTTQRDFCLGNSPLKPGFPLYSFLV |
(restricted) Ga0233414_102075582 | 3300028045 | Seawater | LARRAQTVEIAYLPLRQDLLTQNVLKTAQRNFYLGNNLLI |
Ga0257139_10224101 | 3300028620 | Marine | KLAFGPQTLDIAYLPLRHDFLAKNVLMTAQRDFPLGNSQLTAQNQPTPFA |
Ga0257144_10318851 | 3300029638 | Marine | MSKLAFRPQTVDIAYLPLRQDFLAKNVLMTAQRDYGLGNSFFLSMAGLTPN |
Ga0315554_12947241 | 3300031255 | Salt Marsh Sediment | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTAQRDFRLGNIRSGTD |
Ga0307428_11430111 | 3300031280 | Salt Marsh | QTLDIAYLPLRQDLLAKNVLMTAQRDFRLDNSLLKNLPLGPI |
Ga0307435_10940851 | 3300031357 | Salt Marsh | MSKLAFRAQTVDIAYPPLRQHLLAKNVSMTAQRDFRLGN |
Ga0315547_11001033 | 3300031553 | Salt Marsh Sediment | MSKLAFRAQTVDIAYLPLRQDLLAKNVLMTDQRDFGNSLLTMDNGRYLF |
Ga0315547_12237101 | 3300031553 | Salt Marsh Sediment | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDFCLDNSQYKFDGLA |
Ga0315547_12752742 | 3300031553 | Salt Marsh Sediment | AMSKLALWAQTVDIAYLPLRQDLLAKNVLMTAQRDFRLGNRLLIQTV |
Ga0315532_11318572 | 3300031575 | Salt Marsh Sediment | MSKFAFRAQTVDIAYLPLHQDFLAKNVLMTAQRDFRFGN |
Ga0315532_11414241 | 3300031575 | Salt Marsh Sediment | MSKLTFRAQTVDIAYLPLRQDFLAKNVLMTAQRDFRLG |
Ga0315541_10420131 | 3300031586 | Salt Marsh Sediment | IAYLPLRQDLFAKNVLMTAQRNFRLGNSLLKSNLG |
Ga0315541_10461541 | 3300031586 | Salt Marsh Sediment | SLQAMSKLAFRAQTVDIAYLPLRQDLFAKNVLMTVQRDFGKSLLTGDMIHWY |
Ga0315541_10499432 | 3300031586 | Salt Marsh Sediment | MSKLAFRAQTVDIAYLPLRQDLFAKNVLMTTQRDFRMGNSLSYTAIFIDKQRESV |
Ga0315541_10623732 | 3300031586 | Salt Marsh Sediment | MSKLAFRAQTVDIAYLPLHQDLLAKKVLMTAQTDFCLGNSL |
Ga0315541_10951561 | 3300031586 | Salt Marsh Sediment | MSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDYGLGNSPLDTDAAEGS |
Ga0315541_11230291 | 3300031586 | Salt Marsh Sediment | MSKLAFRAQTVDIAYLPLRQDFLAKNVLMTAQRDLR |
Ga0315541_11270213 | 3300031586 | Salt Marsh Sediment | SLQAMSKLAFRAQTVDIAYLPLRQDLFAKNVLMTAQRDF |
Ga0315541_11299132 | 3300031586 | Salt Marsh Sediment | MSKLAFRAQTVDSTYLPLRQALFAKNVLMTAQMDFCLGNSLYELDGISWNL |
Ga0315541_12154711 | 3300031586 | Salt Marsh Sediment | MSKLAFRAQTVDIAYLPLRQDFFAKNVLMTAQRDFRLG |
Ga0315549_10808972 | 3300031654 | Salt Marsh Sediment | MSKLAFRAQTVDIAYLPLHQDLFAKKVLMTAQRDFCLGNSLLIIAPILLVF |
Ga0315546_11546681 | 3300032029 | Salt Marsh Sediment | SKLAFRAQTVDIAYLPLRQDLFAKNVLMTVQRDFGKSLLTGDMIHWY |
⦗Top⦘ |