NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F024001

Metagenome / Metatranscriptome Family F024001

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F024001
Family Type Metagenome / Metatranscriptome
Number of Sequences 208
Average Sequence Length 43 residues
Representative Sequence RKNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKM
Number of Associated Samples 116
Number of Associated Scaffolds 208

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 9.62 %
% of genes near scaffold ends (potentially truncated) 80.29 %
% of genes from short scaffolds (< 2000 bps) 83.17 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.288 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Sediment → Marine
(10.577 % of family members)
Environment Ontology (ENVO) Unclassified
(35.096 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(38.462 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.00%    β-sheet: 0.00%    Coil/Unstructured: 60.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 208 Family Scaffolds
PF00072Response_reg 1.92
PF13248zf-ribbon_3 1.44
PF02518HATPase_c 1.44
PF00398RrnaAD 1.44
PF07992Pyr_redox_2 1.44
PF07883Cupin_2 1.44
PF13478XdhC_C 1.44
PF13439Glyco_transf_4 0.96
PF03480DctP 0.96
PF06808DctM 0.96
PF00005ABC_tran 0.96
PF00004AAA 0.96
PF07683CobW_C 0.96
PF03313SDH_alpha 0.96
PF02464CinA 0.96
PF00561Abhydrolase_1 0.96
PF00491Arginase 0.96
PF01326PPDK_N 0.96
PF02190LON_substr_bdg 0.96
PF07963N_methyl 0.96
PF010733Beta_HSD 0.96
PF13588HSDR_N_2 0.96
PF00528BPD_transp_1 0.96
PF02317Octopine_DH 0.96
PF01510Amidase_2 0.96
PF01676Metalloenzyme 0.96
PF01790LGT 0.96
PF03739LptF_LptG 0.96
PF00679EFG_C 0.48
PF07298NnrU 0.48
PF11716MDMPI_N 0.48
PF00476DNA_pol_A 0.48
PF01810LysE 0.48
PF030614HBT 0.48
PF01144CoA_trans 0.48
PF00496SBP_bac_5 0.48
PF17186Lipocalin_9 0.48
PF01106NifU 0.48
PF01734Patatin 0.48
PF01042Ribonuc_L-PSP 0.48
PF13589HATPase_c_3 0.48
PF02625XdhC_CoxI 0.48
PF01645Glu_synthase 0.48
PF00266Aminotran_5 0.48
PF10672Methyltrans_SAM 0.48
PF06050HGD-D 0.48
PF06271RDD 0.48
PF13414TPR_11 0.48
PF01238PMI_typeI_C 0.48
PF00990GGDEF 0.48
PF02085Cytochrom_CIII 0.48
PF01699Na_Ca_ex 0.48
PF00575S1 0.48
PF02913FAD-oxidase_C 0.48
PF12710HAD 0.48
PF11967RecO_N 0.48
PF03009GDPD 0.48
PF09585Lin0512_fam 0.48
PF13365Trypsin_2 0.48
PF00582Usp 0.48
PF01493GXGXG 0.48
PF13561adh_short_C2 0.48
PF14691Fer4_20 0.48
PF00475IGPD 0.48
PF08220HTH_DeoR 0.48
PF00850Hist_deacetyl 0.48
PF01019G_glu_transpept 0.48
PF02775TPP_enzyme_C 0.48
PF00107ADH_zinc_N 0.48
PF02080TrkA_C 0.48
PF16822ALGX 0.48
PF01165Ribosomal_S21 0.48
PF09754PAC2 0.48
PF00675Peptidase_M16 0.48
PF03477ATP-cone 0.48
PF03764EFG_IV 0.48
PF13416SBP_bac_8 0.48
PF02310B12-binding 0.48
PF08241Methyltransf_11 0.48
PF11059DUF2860 0.48
PF00460Flg_bb_rod 0.48
PF01425Amidase 0.48
PF027395_3_exonuc_N 0.48
PF14815NUDIX_4 0.48
PF10276zf-CHCC 0.48
PF00829Ribosomal_L21p 0.48
PF03601Cons_hypoth698 0.48
PF04324Fer2_BFD 0.48
PF07238PilZ 0.48
PF01926MMR_HSR1 0.48
PF06415iPGM_N 0.48
PF07973tRNA_SAD 0.48
PF02779Transket_pyr 0.48
PF01799Fer2_2 0.48
PF13380CoA_binding_2 0.48
PF00437T2SSE 0.48
PF08352oligo_HPY 0.48
PF02653BPD_transp_2 0.48
PF07977FabA 0.48
PF00206Lyase_1 0.48
PF02635DrsE 0.48
PF13489Methyltransf_23 0.48
PF00583Acetyltransf_1 0.48
PF07228SpoIIE 0.48
PF07878RHH_5 0.48
PF00903Glyoxalase 0.48
PF00080Sod_Cu 0.48
PF01738DLH 0.48
PF13597NRDD 0.48
PF01566Nramp 0.48
PF13590DUF4136 0.48
PF08899DUF1844 0.48
PF01408GFO_IDH_MocA 0.48
PF13692Glyco_trans_1_4 0.48
PF08279HTH_11 0.48
PF06897DUF1269 0.48
PF14334DUF4390 0.48
PF13304AAA_21 0.48
PF00498FHA 0.48
PF01547SBP_bac_1 0.48

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 208 Family Scaffolds
COG003016S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity)Translation, ribosomal structure and biogenesis [J] 1.44
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.96
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.96
COG0523Zinc metallochaperone YeiR/ZagA and related GTPases, G3E familyGeneral function prediction only [R] 0.96
COG0574Phosphoenolpyruvate synthase/pyruvate phosphate dikinaseCarbohydrate transport and metabolism [G] 0.96
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.96
COG0795Lipopolysaccharide export LptBFGC system, permease protein LptFCell wall/membrane/envelope biogenesis [M] 0.96
COG1546Nicotinamide mononucleotide (NMN) deamidase PncCCoenzyme transport and metabolism [H] 0.96
COG1760L-serine deaminaseAmino acid transport and metabolism [E] 0.96
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.48
COG0131Imidazoleglycerol phosphate dehydratase HisBAmino acid transport and metabolism [E] 0.48
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.48
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.48
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 0.48
COG0261Ribosomal protein L21Translation, ribosomal structure and biogenesis [J] 0.48
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.48
COG0387Cation (Ca2+/Na+/K+)/H+ antiporter ChaAInorganic ion transport and metabolism [P] 0.48
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.48
COG0480Translation elongation factor EF-G, a GTPaseTranslation, ribosomal structure and biogenesis [J] 0.48
COG0530Ca2+/Na+ antiporterInorganic ion transport and metabolism [P] 0.48
COG0584Glycerophosphoryl diester phosphodiesteraseLipid transport and metabolism [I] 0.48
COG0694Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domainPosttranslational modification, protein turnover, chaperones [O] 0.48
COG0696Phosphoglycerate mutase (BPG-independent), AlkP superfamilyCarbohydrate transport and metabolism [G] 0.48
COG0749DNA polymerase I, 3'-5' exonuclease and polymerase domainsReplication, recombination and repair [L] 0.48
COG07643-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydrataseLipid transport and metabolism [I] 0.48
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 0.48
COG1256Flagellar hook-associated protein FlgKCell motility [N] 0.48
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.48
COG1482Mannose-6-phosphate isomerase, class ICarbohydrate transport and metabolism [G] 0.48
COG1558Flagellar basal body rod protein FlgCCell motility [N] 0.48
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 0.48
COG1749Flagellar hook protein FlgECell motility [N] 0.48
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.48
COG1775Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdBAmino acid transport and metabolism [E] 0.48
COG1788Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunitLipid transport and metabolism [I] 0.48
COG1815Flagellar basal body rod protein FlgBCell motility [N] 0.48
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.48
COG1975Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF familyPosttranslational modification, protein turnover, chaperones [O] 0.48
COG2032Cu/Zn superoxide dismutaseInorganic ion transport and metabolism [P] 0.48
COG2057Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunitLipid transport and metabolism [I] 0.48
COG2855Uncharacterized membrane protein YadS, UPF0324 familyFunction unknown [S] 0.48
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.48
COG4094Uncharacterized membrane proteinFunction unknown [S] 0.48
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.48
COG4670Acyl CoA:acetate/3-ketoacid CoA transferaseLipid transport and metabolism [I] 0.48
COG4706Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domainLipid transport and metabolism [I] 0.48
COG4786Flagellar basal body rod protein FlgGCell motility [N] 0.48
COG4787Flagellar basal body rod protein FlgFCell motility [N] 0.48
COG4803Uncharacterized membrane proteinFunction unknown [S] 0.48

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.25 %
UnclassifiedrootN/A18.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000124|BS_KBA_SWE12_21mDRAFT_c10072986All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria873Open in IMG/M
3300000241|BS_KBA_SWE21_205mDRAFT_10086504All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1684Open in IMG/M
3300001371|BBDRAFT_10404881All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1793Open in IMG/M
3300001685|JGI24024J18818_10119973All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300002822|BMAI_1057237All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1232Open in IMG/M
3300002822|BMAI_1062064All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1848Open in IMG/M
3300003886|Ga0063293_10759800All Organisms → cellular organisms → Bacteria → Proteobacteria606Open in IMG/M
3300004000|Ga0055458_10247309All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300004001|Ga0055450_10134891All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria898Open in IMG/M
3300004003|Ga0055445_10089482All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300004004|Ga0055451_10259698All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1714Open in IMG/M
3300004011|Ga0055460_10036704Not Available1203Open in IMG/M
3300004014|Ga0055456_10078112All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1034Open in IMG/M
3300004018|Ga0055452_10330723All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_87516Open in IMG/M
3300004048|Ga0055494_10075509All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales693Open in IMG/M
3300004073|Ga0055516_10189923Not Available516Open in IMG/M
3300004113|Ga0065183_10588014All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1568Open in IMG/M
3300004147|Ga0055515_10039703All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1018Open in IMG/M
3300004148|Ga0055521_10020720All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1231Open in IMG/M
3300005588|Ga0070728_10536563All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria609Open in IMG/M
3300005590|Ga0070727_10865335All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1508Open in IMG/M
3300005600|Ga0070726_10612306Not Available550Open in IMG/M
3300005612|Ga0070723_10714763All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria509Open in IMG/M
3300005826|Ga0074477_1356064All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1555Open in IMG/M
3300005832|Ga0074469_10006156All Organisms → cellular organisms → Bacteria → Proteobacteria1247Open in IMG/M
3300005832|Ga0074469_11023518All Organisms → cellular organisms → Bacteria → Proteobacteria11355Open in IMG/M
3300005939|Ga0075123_10009608All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4134Open in IMG/M
3300006467|Ga0099972_10277893All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfococcus → Desulfococcus multivorans6230Open in IMG/M
3300006467|Ga0099972_11071005All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1825Open in IMG/M
3300006467|Ga0099972_11185683All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria608Open in IMG/M
3300006467|Ga0099972_11239727All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300006467|Ga0099972_12222289All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1838Open in IMG/M
3300006467|Ga0099972_12249328All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1058Open in IMG/M
3300006467|Ga0099972_12283296All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300006467|Ga0099972_13228193All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1781Open in IMG/M
3300006467|Ga0099972_13252407Not Available913Open in IMG/M
3300006467|Ga0099972_13287139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus1551Open in IMG/M
3300007510|Ga0105013_1108202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1936Open in IMG/M
3300007764|Ga0102950_1206912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales590Open in IMG/M
3300008409|Ga0114885_10421All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis12639Open in IMG/M
3300008468|Ga0115358_10006739All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1756Open in IMG/M
3300008627|Ga0115656_1071689All Organisms → cellular organisms → Bacteria1732Open in IMG/M
3300009060|Ga0102962_1066581Not Available1018Open in IMG/M
3300009138|Ga0102959_1171158All Organisms → cellular organisms → Bacteria → Proteobacteria685Open in IMG/M
3300009149|Ga0114918_10030677All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae3844Open in IMG/M
3300009494|Ga0127413_10217705Not Available778Open in IMG/M
3300009506|Ga0118657_10370483All Organisms → cellular organisms → Bacteria1895Open in IMG/M
3300009509|Ga0123573_10483939All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont1179Open in IMG/M
3300009509|Ga0123573_11470312Not Available634Open in IMG/M
3300010292|Ga0126326_1000257All Organisms → cellular organisms → Bacteria19819Open in IMG/M
3300010295|Ga0126334_10002494All Organisms → cellular organisms → Bacteria6448Open in IMG/M
3300010298|Ga0126325_10000271All Organisms → cellular organisms → Bacteria13864Open in IMG/M
3300010392|Ga0118731_100130730All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium595Open in IMG/M
3300010392|Ga0118731_102123608All Organisms → cellular organisms → Archaea → Euryarchaeota1525Open in IMG/M
3300010392|Ga0118731_102683734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → Roseovarius lutimaris580Open in IMG/M
3300010392|Ga0118731_103749611All Organisms → cellular organisms → Bacteria3632Open in IMG/M
3300010392|Ga0118731_105460011All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2026Open in IMG/M
3300010392|Ga0118731_108219693All Organisms → cellular organisms → Bacteria → Proteobacteria1117Open in IMG/M
3300010392|Ga0118731_109275674All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae11802Open in IMG/M
3300010392|Ga0118731_109794030Not Available956Open in IMG/M
3300010392|Ga0118731_111278893All Organisms → cellular organisms → Bacteria1625Open in IMG/M
3300010392|Ga0118731_111328073All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin126919Open in IMG/M
3300010392|Ga0118731_111586743All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2102Open in IMG/M
3300010392|Ga0118731_112948831All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1813Open in IMG/M
3300010413|Ga0136851_10525962All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont1177Open in IMG/M
3300010430|Ga0118733_100286526All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3258Open in IMG/M
3300010430|Ga0118733_100291255All Organisms → cellular organisms → Bacteria3229Open in IMG/M
3300010430|Ga0118733_101535999All Organisms → cellular organisms → Bacteria → Proteobacteria1327Open in IMG/M
3300010430|Ga0118733_103720140All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae824Open in IMG/M
3300010430|Ga0118733_106290054All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatirhabdium → Desulfatirhabdium butyrativorans621Open in IMG/M
3300010430|Ga0118733_106318504All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1619Open in IMG/M
3300010430|Ga0118733_107177438All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1579Open in IMG/M
3300010430|Ga0118733_107645008All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1560Open in IMG/M
3300010997|Ga0139324_1065849All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300013103|Ga0164318_11289627Not Available591Open in IMG/M
3300013118|Ga0171656_1221758Not Available752Open in IMG/M
3300014260|Ga0075307_1002549All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2796Open in IMG/M
3300014264|Ga0075308_1004449All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium2360Open in IMG/M
3300014264|Ga0075308_1119618All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1582Open in IMG/M
3300014295|Ga0075305_1028643All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300014295|Ga0075305_1069235All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1675Open in IMG/M
3300014307|Ga0075304_1003437All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3342Open in IMG/M
3300014307|Ga0075304_1012670All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1709Open in IMG/M
3300014307|Ga0075304_1016165All Organisms → cellular organisms → Bacteria1516Open in IMG/M
3300014307|Ga0075304_1016227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1514Open in IMG/M
3300014315|Ga0075350_1186369Not Available541Open in IMG/M
3300014316|Ga0075339_1049443All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300014316|Ga0075339_1070026All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales904Open in IMG/M
3300014316|Ga0075339_1136051Not Available669Open in IMG/M
3300014316|Ga0075339_1214696All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300014317|Ga0075343_1045912All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300014319|Ga0075348_1045889All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300014319|Ga0075348_1151768Not Available615Open in IMG/M
3300014903|Ga0164321_10445124All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1645Open in IMG/M
3300017990|Ga0180436_11059556All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium616Open in IMG/M
3300017990|Ga0180436_11529431All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1515Open in IMG/M
3300017992|Ga0180435_10459195All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300017992|Ga0180435_10688380All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300017992|Ga0180435_11586268All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium568Open in IMG/M
3300017992|Ga0180435_11633214All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria560Open in IMG/M
3300019707|Ga0193989_1047742All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300019710|Ga0194009_1015320Not Available841Open in IMG/M
3300019711|Ga0193993_1015295All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria818Open in IMG/M
3300019713|Ga0193987_1024211Not Available683Open in IMG/M
3300019716|Ga0193984_1043664All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1578Open in IMG/M
3300019718|Ga0193999_1025218All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300019729|Ga0193968_1050323All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300019743|Ga0193992_1075762All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_123513Open in IMG/M
3300021351|Ga0210365_10510694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1760Open in IMG/M
3300021351|Ga0210365_10548293All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300021351|Ga0210365_10634428Not Available1481Open in IMG/M
3300021351|Ga0210365_10657345All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium638Open in IMG/M
3300021351|Ga0210365_10872761All Organisms → cellular organisms → Bacteria1408Open in IMG/M
3300021351|Ga0210365_11240937All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium755Open in IMG/M
3300021351|Ga0210365_11240946All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2993Open in IMG/M
3300022188|Ga0190313_1141699All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300022202|Ga0224498_10062386All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina1057Open in IMG/M
3300022206|Ga0224499_10221704Not Available643Open in IMG/M
3300022206|Ga0224499_10318433Not Available525Open in IMG/M
3300022218|Ga0224502_10080442All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300022220|Ga0224513_10174435Not Available839Open in IMG/M
3300022306|Ga0224509_10033424All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini1710Open in IMG/M
3300023298|Ga0222638_1026549All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1105Open in IMG/M
(restricted) 3300024528|Ga0255045_10493718All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria508Open in IMG/M
3300025561|Ga0210119_1057626All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria741Open in IMG/M
3300025568|Ga0210095_1017930All Organisms → cellular organisms → Bacteria1617Open in IMG/M
3300025568|Ga0210095_1043246Not Available1064Open in IMG/M
3300025568|Ga0210095_1079345All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300025568|Ga0210095_1131311All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria602Open in IMG/M
3300025583|Ga0210085_1026427All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1773Open in IMG/M
3300025583|Ga0210085_1052462Not Available1161Open in IMG/M
3300025628|Ga0208902_1025983Not Available1988Open in IMG/M
3300025698|Ga0208771_1021125All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2182Open in IMG/M
3300025698|Ga0208771_1080723Not Available944Open in IMG/M
3300025801|Ga0210097_1038325All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 11079Open in IMG/M
3300025883|Ga0209456_10019013All Organisms → cellular organisms → Bacteria3071Open in IMG/M
3300025995|Ga0210079_1033916All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300025995|Ga0210079_1046395Not Available707Open in IMG/M
3300026031|Ga0208909_1034024Not Available520Open in IMG/M
3300026033|Ga0208652_1042513All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria515Open in IMG/M
3300026042|Ga0208538_1011454All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300026072|Ga0208292_1005984All Organisms → cellular organisms → Bacteria → Proteobacteria1405Open in IMG/M
3300027758|Ga0209379_10198960Not Available691Open in IMG/M
3300027852|Ga0209345_10709347Not Available549Open in IMG/M
3300027858|Ga0209013_10010816All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae7425Open in IMG/M
3300027858|Ga0209013_10045323All Organisms → cellular organisms → Bacteria3122Open in IMG/M
3300027917|Ga0209536_100217637All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2396Open in IMG/M
3300027917|Ga0209536_101671678All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont771Open in IMG/M
3300028920|Ga0272441_10521591All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont960Open in IMG/M
3300028920|Ga0272441_10762063All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300030616|Ga0272442_10470778Not Available824Open in IMG/M
3300030616|Ga0272442_10868384Not Available538Open in IMG/M
3300031256|Ga0315556_1170332All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria787Open in IMG/M
3300031256|Ga0315556_1204377All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300031359|Ga0307426_1001823All Organisms → cellular organisms → Bacteria13665Open in IMG/M
3300031364|Ga0307445_10124916All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1949Open in IMG/M
3300031367|Ga0307440_1189565All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria560Open in IMG/M
3300031371|Ga0307423_1025326All Organisms → cellular organisms → Bacteria2180Open in IMG/M
3300031371|Ga0307423_1111290Not Available815Open in IMG/M
3300031371|Ga0307423_1215353All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1536Open in IMG/M
3300031665|Ga0316575_10032121All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2055Open in IMG/M
3300031665|Ga0316575_10289640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1691Open in IMG/M
3300031691|Ga0316579_10344490All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300031727|Ga0316576_10005641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria7687Open in IMG/M
3300031727|Ga0316576_10343573All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1111Open in IMG/M
3300031728|Ga0316578_10138953All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1463Open in IMG/M
3300031728|Ga0316578_10153528Not Available1387Open in IMG/M
3300031728|Ga0316578_10193881All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1224Open in IMG/M
3300031733|Ga0316577_10150352All Organisms → cellular organisms → Bacteria1312Open in IMG/M
3300031733|Ga0316577_10357567Not Available829Open in IMG/M
3300031733|Ga0316577_10577911All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria639Open in IMG/M
3300032061|Ga0315540_10126462All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1155Open in IMG/M
3300032061|Ga0315540_10173850All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium946Open in IMG/M
3300032061|Ga0315540_10243762All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13762Open in IMG/M
3300032133|Ga0316583_10026259All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis2078Open in IMG/M
3300032133|Ga0316583_10165860All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae769Open in IMG/M
3300032136|Ga0316201_10382192All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1214Open in IMG/M
3300032137|Ga0316585_10006434All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae3358Open in IMG/M
3300032137|Ga0316585_10095826All Organisms → cellular organisms → Archaea → TACK group972Open in IMG/M
3300032137|Ga0316585_10096723All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300032168|Ga0316593_10188053Not Available760Open in IMG/M
3300032231|Ga0316187_10621095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae804Open in IMG/M
3300032251|Ga0316198_10006963All Organisms → cellular organisms → Bacteria → Proteobacteria7021Open in IMG/M
3300032251|Ga0316198_10012144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae5346Open in IMG/M
3300032251|Ga0316198_10049249All Organisms → cellular organisms → Bacteria2546Open in IMG/M
3300032251|Ga0316198_10107228All Organisms → cellular organisms → Bacteria1652Open in IMG/M
3300032252|Ga0316196_10353050All Organisms → cellular organisms → Bacteria → Proteobacteria633Open in IMG/M
3300032259|Ga0316190_10984400All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300032263|Ga0316195_10196022All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300032263|Ga0316195_10246008All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300032263|Ga0316195_10276511Not Available884Open in IMG/M
3300032272|Ga0316189_10025371All Organisms → cellular organisms → Bacteria5305Open in IMG/M
3300032272|Ga0316189_10040629All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4041Open in IMG/M
3300032272|Ga0316189_10392237All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300032272|Ga0316189_10577563Not Available862Open in IMG/M
3300032272|Ga0316189_11060531All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1613Open in IMG/M
3300032276|Ga0316188_10080806All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1571Open in IMG/M
3300032276|Ga0316188_10102673All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1398Open in IMG/M
3300033429|Ga0316193_10000699All Organisms → cellular organisms → Bacteria21512Open in IMG/M
3300033429|Ga0316193_10546202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Algihabitans → Algihabitans albus923Open in IMG/M
3300033429|Ga0316193_10611659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Rhodocaloribacter → Rhodocaloribacter litoris868Open in IMG/M
3300033429|Ga0316193_10710379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1800Open in IMG/M
3300033429|Ga0316193_10766629Not Available768Open in IMG/M
3300033429|Ga0316193_10938285Not Available688Open in IMG/M
3300033429|Ga0316193_10940566All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium687Open in IMG/M
3300033429|Ga0316193_11486352All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300033524|Ga0316592_1111091Not Available634Open in IMG/M
3300033524|Ga0316592_1168622Not Available521Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine10.58%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands10.10%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands10.10%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere9.13%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment8.17%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment6.25%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow4.81%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment3.85%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.37%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.88%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment2.88%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment2.88%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment2.40%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment1.92%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine1.92%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.92%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.44%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.44%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment1.44%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.44%
Marine Gutless WormsHost-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms1.44%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.96%
Mangrove SoilEnvironmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Soil0.96%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.96%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.96%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.96%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.48%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.48%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine0.48%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.48%
Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents0.48%
Hydrothermal Vent SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment0.48%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.48%
Methane Seep SedimentEnvironmental → Aquatic → Marine → Cold Seeps → Sediment → Methane Seep Sediment0.48%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.48%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.48%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300000241Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5mEnvironmentalOpen in IMG/M
3300001371Baker-B-sedEnvironmentalOpen in IMG/M
3300001685Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2EnvironmentalOpen in IMG/M
3300002822Illumina_Fosmid_BertiogaEnvironmentalOpen in IMG/M
3300003886Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1EnvironmentalOpen in IMG/M
3300004000Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004001Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1EnvironmentalOpen in IMG/M
3300004003Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1EnvironmentalOpen in IMG/M
3300004004Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2EnvironmentalOpen in IMG/M
3300004011Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004014Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2EnvironmentalOpen in IMG/M
3300004018Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D2EnvironmentalOpen in IMG/M
3300004048Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2EnvironmentalOpen in IMG/M
3300004073Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordB_D2EnvironmentalOpen in IMG/M
3300004113Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2)EnvironmentalOpen in IMG/M
3300004147Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2EnvironmentalOpen in IMG/M
3300004148Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300005588Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300005826Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBAEnvironmentalOpen in IMG/M
3300005832Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBBEnvironmentalOpen in IMG/M
3300005939Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKXEnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300007510Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300007764Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MGEnvironmentalOpen in IMG/M
3300008409Coastal sediment microbial communities from intertidal sand flat, Janssand, Germany_1868_binCEnvironmentalOpen in IMG/M
3300008468Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC10TEnvironmentalOpen in IMG/M
3300008627Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 2.7-0.2umEnvironmentalOpen in IMG/M
3300009060Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D2_MGEnvironmentalOpen in IMG/M
3300009138Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MGEnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009494Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 12-14 cmbsfEnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009509Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11EnvironmentalOpen in IMG/M
3300010292Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-67 metaGHost-AssociatedOpen in IMG/M
3300010295Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-49 metaGHost-AssociatedOpen in IMG/M
3300010298Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaGHost-AssociatedOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010413Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300010997ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)EnvironmentalOpen in IMG/M
3300013103Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cmEnvironmentalOpen in IMG/M
3300013118Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 314m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300014260Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014264Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rdEnvironmentalOpen in IMG/M
3300014295Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1EnvironmentalOpen in IMG/M
3300014307Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1EnvironmentalOpen in IMG/M
3300014315Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1EnvironmentalOpen in IMG/M
3300014316Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1EnvironmentalOpen in IMG/M
3300014317Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300014319Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1EnvironmentalOpen in IMG/M
3300014903Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cmEnvironmentalOpen in IMG/M
3300017990Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaGEnvironmentalOpen in IMG/M
3300017992Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_1 metaGEnvironmentalOpen in IMG/M
3300019707Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_0-1_MGEnvironmentalOpen in IMG/M
3300019710Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_5-6_MGEnvironmentalOpen in IMG/M
3300019711Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_4-5_MGEnvironmentalOpen in IMG/M
3300019713Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_3-4_MGEnvironmentalOpen in IMG/M
3300019716Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_0-1_MGEnvironmentalOpen in IMG/M
3300019718Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_5-6_MGEnvironmentalOpen in IMG/M
3300019729Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_4-5_MGEnvironmentalOpen in IMG/M
3300019743Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_3-4_MGEnvironmentalOpen in IMG/M
3300021351Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.637 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022188Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-10-11_MGEnvironmentalOpen in IMG/M
3300022202Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022206Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022218Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022220Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21EnvironmentalOpen in IMG/M
3300022306Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24EnvironmentalOpen in IMG/M
3300023298Saline water microbial communities from Ace Lake, Antarctica - #183EnvironmentalOpen in IMG/M
3300024528 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23EnvironmentalOpen in IMG/M
3300025561Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025568Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025583Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025628Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKH (SPAdes)EnvironmentalOpen in IMG/M
3300025698Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX (SPAdes)EnvironmentalOpen in IMG/M
3300025801Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025883Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes)EnvironmentalOpen in IMG/M
3300025995Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026031Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd (SPAdes)EnvironmentalOpen in IMG/M
3300026033Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026042Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026072Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027758Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027852Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes)EnvironmentalOpen in IMG/M
3300027858Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028920Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6NEnvironmentalOpen in IMG/M
3300030616Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Form-2OEnvironmentalOpen in IMG/M
3300031256Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10EnvironmentalOpen in IMG/M
3300031359Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-40EnvironmentalOpen in IMG/M
3300031364Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-30EnvironmentalOpen in IMG/M
3300031367Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-10EnvironmentalOpen in IMG/M
3300031371Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-10EnvironmentalOpen in IMG/M
3300031665Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3Host-AssociatedOpen in IMG/M
3300031691Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrAHost-AssociatedOpen in IMG/M
3300031727Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5Host-AssociatedOpen in IMG/M
3300031728Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrCHost-AssociatedOpen in IMG/M
3300031733Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1Host-AssociatedOpen in IMG/M
3300032061Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10EnvironmentalOpen in IMG/M
3300032133Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrAHost-AssociatedOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032137Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrCHost-AssociatedOpen in IMG/M
3300032168Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032231Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1EnvironmentalOpen in IMG/M
3300032251Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxicEnvironmentalOpen in IMG/M
3300032252Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cmEnvironmentalOpen in IMG/M
3300032259Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2EnvironmentalOpen in IMG/M
3300032263Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1EnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300032276Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1EnvironmentalOpen in IMG/M
3300033429Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2EnvironmentalOpen in IMG/M
3300033524Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BS_KBA_SWE12_21mDRAFT_1007298623300000124MarineMFTGTVFIVDAKGSRKNKFAILGVEALAWQGXKTQEYLDIPSFRNAARRDASASKM*
BS_KBA_SWE21_205mDRAFT_1008650423300000241MarineGSRKNKFAILVVEAPGWQGAKRQEYLDIPLDIPSFRNAAGRDASASKM*
BBDRAFT_1040488113300001371Marine EstuarineFKISGAEAPDWQGANTQEYLDIPSFRNAARQDASAYKM*
JGI24024J18818_1011997333300001685MarineNKFTFLGVEAPDWQGTKAKEYQDIPCFSNAARRDGSTDKM*
BMAI_105723723300002822Mangrove SoilLASTTKGSRKNKFAILGVEAPGWQCVKTQEYLEIPSFRTGGRDASTAKM*
BMAI_106206433300002822Mangrove SoilMMRRFHEKNRFAILGVEAPGRQGVKTLEYMDIPSFRTVARRDASASKM*
Ga0063293_1075980023300003886Hydrothermal VentsMNNFTFLGVEAPVWQGAKVAEIGDISSFRNAVRQAVRQDESA
Ga0055458_1024730923300004000Natural And Restored WetlandsGSRKNKFAILGVEAPAWQGVKTQEYLDIPSFRNAARRDASASRM*
Ga0055450_1013489123300004001Natural And Restored WetlandsMISSAKGSRKNKFAILAVEALAWQGAKTQEYLDIPIFRNAARRDAAASKT*
Ga0055445_1008948213300004003Natural And Restored WetlandsFGVVTPGRQGTKTQVYFDIPKFRNAAGRDVLAPEMVSCF*
Ga0055451_1025969813300004004Natural And Restored WetlandsSGFNGSRKSKFAILGVEAPALQGAKKQEYWDIPSFRNAAGRDASASKM*
Ga0055460_1003670413300004011Natural And Restored WetlandsSAYQPNNKIAKGSRKNKFTILGVAAPDWQGTKTQEYLDIPSFHNAAGRDASAYKM*
Ga0055456_1007811223300004014Natural And Restored WetlandsMNGATAVKGSRKNLFTILGVEAPVGQGAKAQEYLDIPSFRNAAGRDASA
Ga0055452_1033072323300004018Natural And Restored WetlandsGSRKNKFAILGVEAPAWQGAKTQEYLDIPSFCNAARRDASASKM*
Ga0055494_1007550923300004048Natural And Restored WetlandsVVTADANTQGSRKNEFAIMGVEAPDRQGAKTQEYLDIPSFRNTAERDASAAKM*
Ga0055516_1018992313300004073Natural And Restored WetlandsMLNRLVSKGSRKNKFTILGIQAPGRQNAKTQEYLDIPSFRNAVGRDASA
Ga0065183_1058801413300004113Pelagic MarineLMIFAPKGSRKNKFKIFAVEAPVRQGTKRQDYLDIPDFRNAAGQNASACKM*
Ga0055515_1003970313300004147Natural And Restored WetlandsMYRFTVLTGKDSRKNKLAILDVVAPGQQGTKTHEYLDIQSLRNAAGRDASASKM*
Ga0055521_1002072043300004148Natural And Restored WetlandsMGSLKNKIAFLGVAAPDRQGAKTQEYLDIPGFGNTAGRVAPTSKM*
Ga0070728_1053656333300005588Marine SedimentFTILGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM*
Ga0070727_1086533523300005590Marine SedimentILGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM*
Ga0070726_1061230623300005600Marine SedimentPNISKSDFKLLVAKSLRKNKFAVLGVEAPGRQGAKTQEYLDIPSFCNTAGRDASASKM*
Ga0070723_1071476323300005612Marine SedimentGSRRNKFTILGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM*
Ga0074477_135606413300005826Sediment (Intertidal)GSRINKFTILGVEARVWQGAKTQEYLDIPSFHNAARRDASVYKM*
Ga0074469_1000615623300005832Sediment (Intertidal)LGRAIRGSRKNQFAVLGVEALLRQGAKTQGYLDIPSFRNAAERDASAYKM*
Ga0074469_1102351823300005832Sediment (Intertidal)MMGKRSAKGSRKNKFTNLGVEAPVGQGAKTQEYLDIPSFRNAARQDASAYKM*
Ga0075123_1000960823300005939Saline LakeMKLTKGSRKNKFAISDVEAPVRQGVGTQEYKHIPSFHNAAGRDVSAPEM*
Ga0099972_1027789393300006467MarineRNKFTILGVEAPVWQGAKAQEYRDIPSFRNAARRDASAYKM*
Ga0099972_1107100513300006467MarineNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKI*
Ga0099972_1118568323300006467MarineGSRKYKFAILGVETPGRQGVKTLEYLDIQSFRHAAGQDASAFKI*
Ga0099972_1123972733300006467MarineMRLSGKGSRRNKFTILGVEAPVWQDAKAQEYRDIPSFRNAARRDASA
Ga0099972_1222228913300006467MarineMGSLKNKFAFLGVEAPNRQGAKTQEYLDIPSFRNTAGRDA
Ga0099972_1224932813300006467MarineGVEAPVWQGAKTQEYRDIPSFRNAARRDASAYKM*
Ga0099972_1228329613300006467MarineIPQGSRKNKFTILGVETPVWQGAKTQEYLDIPSFRNAARRDGSADKM*
Ga0099972_1322819313300006467MarineKFTILSVEVSVWQFTKTHEYLDIPSFRNEAGPNASAYEWN*
Ga0099972_1325240733300006467MarineMSEVQMFQVKGSRINKITILGVETPVWQGAKTQEYLDIPSFRNAARRDASAYKM*
Ga0099972_1328713913300006467MarineVSFLCSLGFTKKKFTILGIEAPVWQGAKTQEYLDIPSFRNAARRDASAHKM*
Ga0105013_110820233300007510MarineGSHKNKLTDLGVQAPGWQGAKARNIWHIPSFRNAARRDAWAHKM*
Ga0102950_120691213300007764SoilGAKAPAWQGAKTQEYPDIPRFRNAAGQDASAYKR*
Ga0114885_1042193300008409SedimentRINKFTILDVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM*
Ga0115358_1000673943300008468SedimentMHKGSHKNKFTILSVEAPDWQGAKAQEYQVIPSFRNAARQDASALKM*
Ga0115656_107168913300008627MarineNKFAILGVEASGRQGAKTKAYLDILSFRNAAGRDASASKM*
Ga0102962_106658123300009060SoilMNKFTILGVEAPVWPCAKPQEYLDIPSFRNAVRRDASAFK
Ga0102959_117115813300009138SoilQMFQVKGSRINKITILGVETPVWQGAKTQEYLDIPSFRNAARRDASAYKM*
Ga0114918_1003067723300009149Deep SubsurfaceMLLDFTRGSRNNKFAILSVEALVWQGAKAQARHIPSFRNAARRDSSAVKM*
Ga0127413_1021770513300009494Methane Seep SedimentLKGSHKNKFAILSVEAPVWQGAKAQEYQDIPSFCNAAMRDASALKM*
Ga0118657_1037048333300009506Mangrove SedimentFNLKQGRPNDNLGSRKNKFAFLGVEAPAWQGANTQEYLDILSFRDAARRDAAVAKM*
Ga0123573_1048393913300009509Mangrove SedimentILGVEAPDRQGAKAQEYLDIPSFRIAAGRDVSAHKM*
Ga0123573_1147031223300009509Mangrove SedimentDVEAPAWQGAKTQEYLDIPSFHNAARRDASVSKM*
Ga0126326_100025713300010292Marine Gutless WormsRRNKFTILGVEAPVGQGAKTQEYRDIPSFRNAARRDASTHNM*
Ga0126334_1000249413300010295Marine Gutless WormsGSRRNKFTILGVEAPVGQGAKTQEYRDIPSFRNAARRDASTHKM*
Ga0126325_1000027113300010298Marine Gutless WormsRRNKFTILGVEAPVGQGAKTQEYRDIPSFRNAARRDASTHKM*
Ga0118731_10013073013300010392MarineKNKFTILGVEAPGWQGVKAQAYRDIPRFHNTARRDASTLKM*
Ga0118731_10212360813300010392MarineGSRRNKFTILGVEAPVWQGAKAQEYLDIPSFRNAARRDASAYKM*
Ga0118731_10268373413300010392MarineSKGSRRNKFTILGVEAPVWQGAKAQEYQDIPSFRNAARRDESAYKM*
Ga0118731_10374961113300010392MarineKNKFTILGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM*
Ga0118731_10546001133300010392MarineGVEAPVWQGAKAQEYRDIPSFRNAARRDASAYKM*
Ga0118731_10821969313300010392MarineKFTILGVEAPVWQDAKAQEYRDIPSFRNAARRDASAYKM*
Ga0118731_10927567463300010392MarineMGSLKNKFAFLGVEAPDRQGAKTQEYLDIPSFRNTAGRDASASKM*
Ga0118731_10979403013300010392MarineNKFTILGVEAPVRQGAKTQEYLDIPSFRNAAGRDASAYKM*
Ga0118731_11127889313300010392MarineGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM*
Ga0118731_11132807333300010392MarineLGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM*
Ga0118731_11158674343300010392MarineSRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKV*
Ga0118731_11294883113300010392MarineNKFTILGVEAPVWQGAKTQEYLDIPSFRNAARRDVSAYKR*
Ga0136851_1052596213300010413Mangrove SedimentILGVEAPDRQGAKAQEYLDIPSFRNAAGREVSAHKM*
Ga0118733_10028652663300010430Marine SedimentLGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKV*
Ga0118733_10029125543300010430Marine SedimentLGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKM*
Ga0118733_10153599923300010430Marine SedimentICVVTAKGSRKNKLAIMGDEAPGRQGTKTQEYLDIPSFRNAAGRDASASKMLSYF*
Ga0118733_10372014033300010430Marine SedimentGSRKNKFVILGVEASGQQGAKMQEYLDIPSFRNTAGRDASASKM*
Ga0118733_10629005423300010430Marine SedimentKGSHKNKFTILGVEAPGWQGVKAEEYRDIPSFHNAVRRDASTYKM*
Ga0118733_10631850413300010430Marine SedimentSQILRVEAPAWQGAKVQEYLDIPSFRNAARRDASACEM*
Ga0118733_10717743813300010430Marine SedimentKFTILGVEAPVWQGAKAQEYLDISSFRNAARRDASAYKM*
Ga0118733_10764500813300010430Marine SedimentNKFTILGVEASDWQGAKTQEYLDIPSFRNAARRDASVYKM*
Ga0139324_106584913300010997SedimentLVILGVEAPGRQGVKPQEYLDIPKFCNAAGRDASATKMAGYF*
Ga0164318_1128962713300013103Marine SedimentILSVEAPDWQGAKAQEYQDIPSFRNVARQDASALKM*
Ga0171656_122175813300013118MarineKFAILGVEAPGRQGAKTLAYLDILSFRNAAGWDASASKM*
Ga0075307_100254933300014260Natural And Restored WetlandsMFAILGVEAPGWQGAKTQEYLDIPSFRNTAGRVASASKM*
Ga0075308_100444923300014264Natural And Restored WetlandsGSRKNKFTILGVEAPVWQGVKTQEYLDIPSFYNAAGQDATAYKM*
Ga0075308_111961813300014264Natural And Restored WetlandsRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKM*
Ga0075305_102864333300014295Natural And Restored WetlandsLIFSPFFNGQGLRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNEARRDASASKM*
Ga0075305_106923513300014295Natural And Restored WetlandsSSAAQGSQKNKFAILGVEAPAWKGAETEEYLDIPSFRYASRRDASASKMWRYF*
Ga0075304_100343733300014307Natural And Restored WetlandsPGRQGVKTQEYQDIPSFRNATGRDASSSKMLILF*
Ga0075304_101267033300014307Natural And Restored WetlandsLIIDIFPFFNGQGSRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNEARRDASASKM*
Ga0075304_101616533300014307Natural And Restored WetlandsAILDVEAPAWQGAKTQEYLDIPSFRNAARRDASASKM*
Ga0075304_101622733300014307Natural And Restored WetlandsSRKNKFAISSVEAPAWQGAKTQEYLDIPSFRNAARRDTSASKM*
Ga0075350_118636923300014315Natural And Restored WetlandsGSRKNKFANLGVEAPAWQGAKTQEYLDIPRFRNAASRDASASEM*
Ga0075339_104944323300014316Natural And Restored WetlandsFAILGVEAPAWQGAKTQEYLDIPSFRNTAKRDASASKM*
Ga0075339_107002633300014316Natural And Restored WetlandsMFTGTVFIVDAKGSRKNKFAILGVEALAWQGAKTQEYLDIPSFRNAARRDASASKM*
Ga0075339_113605113300014316Natural And Restored WetlandsKNKCAILGVEALGRQGAKTQEYLDIQSFRNAAGRDVSAFKM*
Ga0075339_121469613300014316Natural And Restored WetlandsWGSRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDALASKM*
Ga0075343_104591213300014317Natural And Restored WetlandsPIRRIHSNAAWGSRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDALASKM*
Ga0075348_104588933300014319Natural And Restored WetlandsMPSALRGSRKNKLTILGVEAPDRQGAKTQEYLDIPGFRNIDGRDASAYK
Ga0075348_115176823300014319Natural And Restored WetlandsRKNKFAILGVEAPAWQGAKTQEYLYIPSFRNAARRDASASKM*
Ga0164321_1044512413300014903Marine SedimentSLGVEAPAWQGAKVQEYLDIPSFRNAARLDASADKM*
Ga0180436_1105955613300017990Hypersaline Lake SedimentKNKFTISGVEAPVRQGAKTQGYPDIPSFRNAAGRDASAHKM
Ga0180436_1152943113300017990Hypersaline Lake SedimentMSQHAKGSRKNKFTILGVEASVRQGAKTQEYPDIPSFRNAAGRGASAHKM
Ga0180435_1045919513300017992Hypersaline Lake SedimentGSRKNKFTISGVEAPVRQGAKTQEYLDIPSFRNAAGQDASAHKM
Ga0180435_1068838013300017992Hypersaline Lake SedimentRPPEGSRKNKFTELGVEAPGWQGAKPQEYRNISRFCNVARRDASAAKM
Ga0180435_1158626823300017992Hypersaline Lake SedimentFTISGVEAPVRQGAKTQEYLDIPSFRNAAGWDSSAHKM
Ga0180435_1163321413300017992Hypersaline Lake SedimentKFTILGVEAPVRQGAKTQEYLDIPSFRNAARQDAPAHKM
Ga0193989_104774223300019707SedimentLVILGVEAPGQQGVKPQEYLDIPKFCNAAGRDASATKMVSYF
Ga0194009_101532023300019710SedimentLGIAAPAWRGAKTQEYLDLPDFRNAARRDASASKM
Ga0193993_101529533300019711SedimentKTNSRYGATKGSRKNKFTILVVEAPVWQGAKTQEYLDIPSFRNAARRDESADKM
Ga0193987_102421113300019713SedimentNLGVEAPDRQGAKTQECLNIPSFRNIAGRDASAPKM
Ga0193984_104366423300019716SedimentFWGVEAPDRQGAKTQEYLDIPSFRNTDGRDASAYKM
Ga0193999_102521823300019718SedimentMIKKKYASDLRRNKFTILGVEAPVWQGTKTQEYLDIPSFRNAAGRDASTYKM
Ga0193968_105032313300019729SedimentAILGVEAPGRQGAKTQEYLDIPSFRNAARRDASASKM
Ga0193992_107576213300019743SedimentAPVWQGAKTQEYLDIPSFRNVTGRDASAYKTGSYF
Ga0210365_1051069413300021351EstuarineRKNKFTIIGVEAIDWQGAKTQEYLDIPSFRNAARRDASTYKM
Ga0210365_1054829323300021351EstuarineEGSRKNKLVILGVEAPDRQGVKSQEYLDIPRFCNAAGRDASASKIVSYF
Ga0210365_1063442813300021351EstuarineKGSRKNKFAILGVEAPGRQGAKTQEYLDIPSFRNADGRDASASKT
Ga0210365_1065734513300021351EstuarineVILGVEAPGRQGAKSQEYLDIPRFCNADGRDVSASKMASY
Ga0210365_1087276133300021351EstuarineSRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNVARRDASASKM
Ga0210365_1124093723300021351EstuarineLAILGVEAPGRQGAKTQEYLDIPSFRNAVGRDASASKM
Ga0210365_1124094613300021351EstuarineMLEVQVPQVKGSRINKFTILGVEARVWQGAKTQEYLDIPSFHNAARRDASVYKM
Ga0190313_114169913300022188Hydrothermal Vent SedimentLRNNKLAILSVEAPGWQGAKTQEYQDILSFRNAVRQDAS
Ga0224498_1006238613300022202SedimentKFTTLGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM
Ga0224499_1022170423300022206SedimentKFTILDVEALVWQGAKTQEYLDIPSFRNAASRDVSAYKM
Ga0224499_1031843323300022206SedimentGAGSTKGSRINKFTILGAEGPVWQGAKTQEYLDIPSFRNAARRDASAYKM
Ga0224502_1008044213300022218SedimentLGVEASDWQGAKTQEYLDIPSFRNAARRDASAYKM
Ga0224513_1017443513300022220SedimentMIIYDLTNPIFGTKGSRINKFTILGVEAPVWQGAKAQEYLDIPSFRNAARRDASAYKM
Ga0224509_1003342413300022306SedimentMFQVKGSRINKITILGVETPVWQGAKTQEYLDIPSFRNAARRVASAYK
Ga0222638_102654913300023298Saline WaterKGSRKNKFVISDVEAPVRQGVGTQEYKHIPSFHNAAGRDVSAPEM
(restricted) Ga0255045_1049371813300024528SeawaterILGVEAPVWQGAKAQEYLDIPSFRNAARRDASAYKM
Ga0210119_105762623300025561Natural And Restored WetlandsMLNCTNPKGSRKNKFTFLSVEAPAWQGAKAPEYQDISSFRNAAR
Ga0210095_101793033300025568Natural And Restored WetlandsLAGKGSQKNKFAFLADEAPGLQDAKKQEYLDMPSFRNAAGRHGSAFKM
Ga0210095_104324623300025568Natural And Restored WetlandsFATLGAEAPAWQGAKTPEYLDIPSFRNAVRRAASASKM
Ga0210095_107934513300025568Natural And Restored WetlandsNKFAILSVEAPAWQGAKTPEYLDIPSFLNAARRDASVSKM
Ga0210095_113131113300025568Natural And Restored WetlandsKNKFAILADEAPGRQDARKQEYLDMPSFRNAAGRDGSASKM
Ga0210085_102642723300025583Natural And Restored WetlandsMGSRKKKVAILADEAPGRQDAKKQEYLDMPSFRNAAGRDGSASKM
Ga0210085_105246213300025583Natural And Restored WetlandsMISSAKGSRKNKFAILAVEALAWQGAKTQEYLDIPIFRNAARRDAAASKT
Ga0208902_102598313300025628Saline LakeLGVEAPGWQGAKAQEYLDIPSFRNAARRDASAHKM
Ga0208771_102112513300025698Saline LakeLILNKGSRKNKFAISDVEAPVRQGVGTQEYKYIPSFHNAAGRDVSAPEM
Ga0208771_108072323300025698Saline LakeMKLTKGSRKNKFAISDVEAPVRQGVGTQEYKYIPSFHNAAGRDVSA
Ga0210097_103832513300025801Natural And Restored WetlandsMNGATAVKGSRKNLFTILGVEAPVGQGAKAQEYLDIPSFRNAAGRDASAYKM
Ga0209456_1001901313300025883Pelagic MarineGLRINKFTTLDVEAPVWQGAKTQEYLDIPSFRNAARRDVSAYKM
Ga0210079_103391613300025995Natural And Restored WetlandsLRIAFSLNLAMATKGSRKNKFAILGVEAPGRQGAKTQEYLGIPSFRNTAGRDASASKM
Ga0210079_104639513300025995Natural And Restored WetlandsLVILGVEAPGRQGVKPQEYLDIPKFCNAAGRDASATKMAGYF
Ga0208909_103402413300026031Natural And Restored WetlandsYRWWKKPSKGSRKNKFANLGVEAPGRQGAKTKEYLDIPSFCNMAGRDTSAPKM
Ga0208652_104251313300026033Natural And Restored WetlandsKNKLMILGVEAPGRQGVKPQEYLDIPRFCNAAGRDASATKMAGYF
Ga0208538_101145413300026042Natural And Restored WetlandsAKGSRKNKLAILGVEAPGRQGAKTQEYLDIPSFCNAAGRDALASKMLSYF
Ga0208292_100598433300026072Natural And Restored WetlandsMFTGTVFIVDAKGSRKNKFAILGVEALAWQGAKTQEYLDIPSFRNAARRDASASKM
Ga0209379_1019896023300027758Marine SedimentTILGVEAPVWQGAKTQEYRDIPSFRNAARRDASAYKM
Ga0209345_1070934723300027852MarineKFAILGVEAPGRQGAKTQEYLDIPSFRNAAGRDASASKMLTQVRQNYGQKV
Ga0209013_1001081613300027858MarineLAILSVEAPVWQGAKTQEYQDILSFRNAVRRDASALK
Ga0209013_1004532313300027858MarineKNKFTILGVEAPGWQGAKVQEYRDIPNFRNAARRDESAHKM
Ga0209536_10021763713300027917Marine SedimentRKNKFAILGVEAPGRQGVKTPEYLDIPSFRNTDGRDASAYKM
Ga0209536_10167167823300027917Marine SedimentFTILGVEASDWQGAKTQEYLDIPSFRNAARRDASAYKM
Ga0272441_1052159113300028920Marine SedimentRKNKFAILIVEALGWRGTKTQEYLDIPSFRNADGRDESKSKM
Ga0272441_1076206323300028920Marine SedimentMLGVEALGQQGAKTKEYLDIPSFRNAAGRDASVFKM
Ga0272442_1047077823300030616Marine SedimentVTKGSRKNKFAILGVEVPDREGAKTQEYLDIPSFRNTAGRDASAAKM
Ga0272442_1086838413300030616Marine SedimentLGVEAPAWQGAETQEYLDIPSFRNAVRRDAPIFKRRRRWQNG
Ga0315556_117033223300031256Salt Marsh SedimentILGVEAPGRQGVKTQEYLDILSFRNAAGRDASASKM
Ga0315556_120437723300031256Salt Marsh SedimentLGSRENKFTILGIAAPGWQGAKTQEYLDIPSFRNAARRDA
Ga0307426_100182313300031359Salt MarshKYYFIIFFTIQGVEAPVWQDAKTQEYLDIPSFRNAARRDASAYKM
Ga0307445_1012491623300031364Salt MarshFIIFFTIQGVEAPVRQGAKTQEYLDIPSFRNAAGRDASAYKM
Ga0307440_118956513300031367Salt MarshRPHECVRMTKGSSRKNKFAILGVEAPGRQGVKTQEYLDILSFRNAAGRDASASKM
Ga0307423_102532633300031371Salt MarshLAGKGSRKNKFAILADEAPGRQGAKKQEYLDIPSLRNAAGWDGSASKM
Ga0307423_111129013300031371Salt MarshLGVEAPDRQGAKTQEYLDIPSFCNTAGRDASASKM
Ga0307423_121535313300031371Salt MarshKFTILGVEALDRQGAKAQEYLDIPSFRNAAGRDASTYKM
Ga0316575_1003212123300031665RhizosphereFLLDCLASKGSRKNKFAILGVEAPSRQGAKTPEYLDIPSFRNAAGRDASASKM
Ga0316575_1028964033300031665RhizosphereILGVEARGRQGVKTQEYLDIPSFRNAAGRDASVSKM
Ga0316579_1034449023300031691RhizosphereKFVILGVEAPGRQGVKPQEYLDIPKFCNAAGRDASATKMAGYF
Ga0316576_1000564113300031727RhizosphereILKVEAPGRQGAKTKGYQYISSFRNVAGRDASAPKM
Ga0316576_1034357323300031727RhizosphereLGVEALVWQGAKTQEYLDIPSFRNAAKRDASAFKM
Ga0316578_1013895323300031728RhizosphereKFAILGVEAPAWQDAKTQEYLDIPKFRNTARRDGSVSKM
Ga0316578_1015352813300031728RhizosphereILGVEAPGRQGVKPQEYLDIPKFCNAAGRDASATKMAGYF
Ga0316578_1019388123300031728RhizosphereLSIRKVIVLGVEAPAWQGAKKQEYLDIPSFRNAARRDASAFKM
Ga0316577_1015035233300031733RhizosphereNKFAIFGVEAPVCQGAKPQEYLDIPSFRSAARRGASASKM
Ga0316577_1035756713300031733RhizosphereKGSRKNKFTILGVEAPAWQGVKTQEYLDIPSFRNAARRDASVYKM
Ga0316577_1057791123300031733RhizosphereILGVEAPAWKGAKTQEYLDIPSFRNAARREASASKV
Ga0315540_1012646213300032061Salt Marsh SedimentMTCQAKDSRKNKFTILGVAAPGRQGAKAQEYLDIPNFRNAARRDAAAYKM
Ga0315540_1017385013300032061Salt Marsh SedimentILGVEALAWQGAKTQEYLDIPSFRNAVRRDASASKI
Ga0315540_1024376213300032061Salt Marsh SedimentYRSMLPAKGSRKNKFTILGVAAPGWQGAKTQEYLDIPSFRNAARRDAAANKM
Ga0316583_1002625933300032133RhizosphereVILGVEAPGRQGVKLKEYLYIPIFCKAAGRDASAPKMVNDF
Ga0316583_1016586023300032133RhizosphereMGSLKNKFAFLGVAAPDRQGAKTQEYLDIPGFRNTAGRVASPSKM
Ga0316201_1038219233300032136Worm BurrowMGSLKNKFALLGVEAPDRQGAKTQEYLDIPSFRNTAGRDASAS
Ga0316585_1000643413300032137RhizosphereGSRNNKFAILGVEAPGRQGVKTQEYLDIPSFRNAAGRDASASKM
Ga0316585_1009582613300032137RhizosphereKNYFTVLGVEAPGRQGAKTQEYLDIPSFRNAARRDASAYKM
Ga0316585_1009672323300032137RhizosphereILGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKM
Ga0316593_1018805323300032168RhizosphereEKGEFAILGVEAPAWLGVKKQEYRDISSFRNAARQDASASKMRRYF
Ga0316187_1062109523300032231Worm BurrowMGSLKNKFAFLGVEAPDRQGAKTQEYLDIPSFRNTAGRDASASKM
Ga0316198_1000696373300032251SedimentSRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKS
Ga0316198_1001214413300032251SedimentMGSLKNKFAFLGVEAPNRQGAKTQEYLDISSFRNTAGRDASASK
Ga0316198_1004924933300032251SedimentSRKNKFAILGVEAPAWQGAKTQEYLDIPSFRNAARRDASASKM
Ga0316198_1010722823300032251SedimentSLKNKFAFLGVEAPNRQGAKTQEYLDISSFRNTAGRDASASKM
Ga0316196_1035305023300032252SedimentILGVETPVRQGAKTQEYLDIPSFRNAARRDASAYKM
Ga0316190_1098440023300032259Worm BurrowKNKFAFLGVEAPNRQGAKTQEYLDISSFRNTAGRDASASKM
Ga0316195_1019602213300032263SedimentAILGVEAPGRQGAKTQEYLDIPSFRNTVGRDAPASKM
Ga0316195_1024600813300032263SedimentMFAILADEASGRQGKKKQEYLDIPSFRNAAGRDGSASKM
Ga0316195_1027651113300032263SedimentILGVEAPDRQGVKSQEYLDIPRFCNVAGRDASASKMVSHV
Ga0316189_1002537123300032272Worm BurrowMGDEAPGRQGTKTQEYLDIPSFRNAAGRDASASKMLSYF
Ga0316189_1004062963300032272Worm BurrowMFQVKGSRINKITILGVETPVWQGAKTQEYLDIPSFRNAAKRDASAYEM
Ga0316189_1039223723300032272Worm BurrowKNKFAILGVEAPGRQGAKTQEYLDIPSFRNTDGRDASAYKM
Ga0316189_1057756313300032272Worm BurrowRRNKFTILGVEAPVWQGAKAQEYLDIPSFRNAARRDASAYKMGSYF
Ga0316189_1106053123300032272Worm BurrowDTKGSRNNKFAILGTEAPGRQGAKAPEYRDMPSFRNAAGRDASAYKM
Ga0316188_1008080613300032276Worm BurrowMGVEAPGRQGVKSQEYLDIPRFCNAAGRDASASKMVIYFG
Ga0316188_1010267323300032276Worm BurrowMGSLKNKFAFFGVEAPDRQGAKTQEYLDIPSFRNTAGRDASASKM
Ga0316193_10000699273300033429SedimentAAKGSRKNKFTILGVKAPDRQGAKTQEYLDIPSFRNADGRDASASKT
Ga0316193_1054620223300033429SedimentLSASFFGGLGVEAPVWQGAKTQEYLDIPSFRNAAGRDASAY
Ga0316193_1061165913300033429SedimentKKPFKGSRKNKFAILGVEAPGRQGAKTQKYLDIPSFRNTDGRDASAYKM
Ga0316193_1071037923300033429SedimentLNKFTILGVEAPIWQGAKTQEYLDIPSFRNAAKRDASAYKM
Ga0316193_1076662913300033429SedimentKFTILGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM
Ga0316193_1093828513300033429SedimentMSEVQMFQVKGSRINKITILGVETPVWQGAKTQEYLDIPSFRNAAKRDASAYEM
Ga0316193_1094056613300033429SedimentILGVEAPAWQGAKTLEYLDIPSFRNAARRDASVSKI
Ga0316193_1148635213300033429SedimentSRRNKFTILGVEAPVWQGAKTQEYLDIPSFRNAARRDASAYKM
Ga0316592_111109123300033524RhizosphereAILGIEAPDRQSAKTQVDQDIPSFGNAAGRDASASKMLSHF
Ga0316592_116862223300033524RhizosphereKNRFAILGVEAPDWQGAKTQEYLDISSFRNVAGRDASAPKM

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.