Basic Information | |
---|---|
Family ID | F025716 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 200 |
Average Sequence Length | 36 residues |
Representative Sequence | MDDKELERMINAAGLIGAIFGFISGAGLMALVGIIF |
Number of Associated Samples | 119 |
Number of Associated Scaffolds | 200 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 85.50 % |
% of genes near scaffold ends (potentially truncated) | 7.50 % |
% of genes from short scaffolds (< 2000 bps) | 75.50 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (53.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine (15.500 % of family members) |
Environment Ontology (ENVO) | Unclassified (72.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 200 Family Scaffolds |
---|---|---|
PF00145 | DNA_methylase | 12.00 |
PF00182 | Glyco_hydro_19 | 11.00 |
PF13384 | HTH_23 | 4.50 |
PF01541 | GIY-YIG | 3.50 |
PF13539 | Peptidase_M15_4 | 3.50 |
PF14090 | HTH_39 | 2.00 |
PF05866 | RusA | 2.00 |
PF12684 | DUF3799 | 2.00 |
PF13412 | HTH_24 | 2.00 |
PF09374 | PG_binding_3 | 2.00 |
PF01381 | HTH_3 | 1.00 |
PF03237 | Terminase_6N | 1.00 |
PF13481 | AAA_25 | 0.50 |
PF11351 | GTA_holin_3TM | 0.50 |
PF10991 | DUF2815 | 0.50 |
COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 12.00 |
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 11.00 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 11.00 |
COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 2.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 53.00 % |
All Organisms | root | All Organisms | 47.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2236876002|none_p072120 | Not Available | 503 | Open in IMG/M |
3300000101|DelMOSum2010_c10025820 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 3317 | Open in IMG/M |
3300000101|DelMOSum2010_c10047755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2168 | Open in IMG/M |
3300000101|DelMOSum2010_c10057860 | Not Available | 1886 | Open in IMG/M |
3300000101|DelMOSum2010_c10072081 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1582 | Open in IMG/M |
3300000101|DelMOSum2010_c10089081 | Not Available | 1329 | Open in IMG/M |
3300000101|DelMOSum2010_c10193494 | Not Available | 691 | Open in IMG/M |
3300000115|DelMOSum2011_c10005192 | Not Available | 7613 | Open in IMG/M |
3300000115|DelMOSum2011_c10084167 | Not Available | 1093 | Open in IMG/M |
3300000116|DelMOSpr2010_c10252819 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 536 | Open in IMG/M |
3300000928|OpTDRAFT_10166058 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 905 | Open in IMG/M |
3300000928|OpTDRAFT_10168125 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 898 | Open in IMG/M |
3300000973|BBAY93_10133208 | Not Available | 627 | Open in IMG/M |
3300001344|JGI20152J14361_10038586 | Not Available | 1427 | Open in IMG/M |
3300001346|JGI20151J14362_10020980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3438 | Open in IMG/M |
3300001346|JGI20151J14362_10167099 | Not Available | 637 | Open in IMG/M |
3300001349|JGI20160J14292_10005937 | Not Available | 8705 | Open in IMG/M |
3300001349|JGI20160J14292_10179940 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 630 | Open in IMG/M |
3300001352|JGI20157J14317_10070434 | Not Available | 1439 | Open in IMG/M |
3300001352|JGI20157J14317_10118365 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 900 | Open in IMG/M |
3300005589|Ga0070729_10755608 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 520 | Open in IMG/M |
3300005600|Ga0070726_10440308 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 657 | Open in IMG/M |
3300005747|Ga0076924_1052959 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 693 | Open in IMG/M |
3300005837|Ga0078893_14716370 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 500 | Open in IMG/M |
3300006025|Ga0075474_10051832 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1388 | Open in IMG/M |
3300006026|Ga0075478_10090803 | Not Available | 980 | Open in IMG/M |
3300006029|Ga0075466_1089916 | Not Available | 845 | Open in IMG/M |
3300006029|Ga0075466_1131693 | Not Available | 656 | Open in IMG/M |
3300006752|Ga0098048_1004288 | Not Available | 5631 | Open in IMG/M |
3300006752|Ga0098048_1013899 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2783 | Open in IMG/M |
3300006752|Ga0098048_1059127 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1193 | Open in IMG/M |
3300006752|Ga0098048_1060273 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1180 | Open in IMG/M |
3300006793|Ga0098055_1025784 | Not Available | 2467 | Open in IMG/M |
3300006793|Ga0098055_1192855 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 775 | Open in IMG/M |
3300006803|Ga0075467_10130371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 1464 | Open in IMG/M |
3300006810|Ga0070754_10401550 | Not Available | 600 | Open in IMG/M |
3300006867|Ga0075476_10006243 | All Organisms → cellular organisms → Bacteria | 5481 | Open in IMG/M |
3300006867|Ga0075476_10240093 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 649 | Open in IMG/M |
3300006916|Ga0070750_10328108 | Not Available | 649 | Open in IMG/M |
3300006990|Ga0098046_1086028 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 704 | Open in IMG/M |
3300007276|Ga0070747_1070576 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1314 | Open in IMG/M |
3300007276|Ga0070747_1294379 | Not Available | 559 | Open in IMG/M |
3300007540|Ga0099847_1010949 | All Organisms → cellular organisms → Bacteria | 3001 | Open in IMG/M |
3300007540|Ga0099847_1048848 | Not Available | 1335 | Open in IMG/M |
3300007540|Ga0099847_1164976 | Not Available | 655 | Open in IMG/M |
3300007558|Ga0102822_1040786 | Not Available | 1106 | Open in IMG/M |
3300007778|Ga0102954_1231974 | Not Available | 548 | Open in IMG/M |
3300009024|Ga0102811_1245794 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 668 | Open in IMG/M |
3300009074|Ga0115549_1006592 | All Organisms → cellular organisms → Bacteria | 5536 | Open in IMG/M |
3300009074|Ga0115549_1083687 | Not Available | 1084 | Open in IMG/M |
3300009074|Ga0115549_1182904 | Not Available | 672 | Open in IMG/M |
3300009074|Ga0115549_1278718 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 528 | Open in IMG/M |
3300009076|Ga0115550_1007652 | Not Available | 6123 | Open in IMG/M |
3300009076|Ga0115550_1071615 | Not Available | 1345 | Open in IMG/M |
3300009076|Ga0115550_1090444 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1149 | Open in IMG/M |
3300009077|Ga0115552_1067027 | Not Available | 1606 | Open in IMG/M |
3300009079|Ga0102814_10338180 | Not Available | 819 | Open in IMG/M |
3300009086|Ga0102812_10158712 | Not Available | 1236 | Open in IMG/M |
3300009086|Ga0102812_10420632 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 728 | Open in IMG/M |
3300009423|Ga0115548_1036275 | Not Available | 1845 | Open in IMG/M |
3300009433|Ga0115545_1094015 | Not Available | 1092 | Open in IMG/M |
3300009435|Ga0115546_1193030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-13 | 707 | Open in IMG/M |
3300009436|Ga0115008_10164425 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1607 | Open in IMG/M |
3300009438|Ga0115559_1028735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2613 | Open in IMG/M |
3300009443|Ga0115557_1100417 | Not Available | 1220 | Open in IMG/M |
3300009443|Ga0115557_1260903 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 661 | Open in IMG/M |
3300009467|Ga0115565_10137799 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1141 | Open in IMG/M |
3300009472|Ga0115554_1235215 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 736 | Open in IMG/M |
3300009496|Ga0115570_10232196 | Not Available | 820 | Open in IMG/M |
3300010149|Ga0098049_1006238 | Not Available | 4208 | Open in IMG/M |
3300010149|Ga0098049_1112918 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 847 | Open in IMG/M |
3300011118|Ga0114922_10638135 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 876 | Open in IMG/M |
3300011258|Ga0151677_1003359 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2202 | Open in IMG/M |
3300013010|Ga0129327_10077987 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1633 | Open in IMG/M |
3300013010|Ga0129327_10286544 | Not Available | 849 | Open in IMG/M |
3300013010|Ga0129327_10656901 | Not Available | 584 | Open in IMG/M |
3300017713|Ga0181391_1138123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Eggerthellales → Eggerthellaceae → Adlercreutzia → unclassified Adlercreutzia → Adlercreutzia sp. ZJ242 | 542 | Open in IMG/M |
3300017721|Ga0181373_1013948 | All Organisms → Viruses → Predicted Viral | 1505 | Open in IMG/M |
3300017721|Ga0181373_1014760 | All Organisms → Viruses | 1460 | Open in IMG/M |
3300017721|Ga0181373_1087134 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 555 | Open in IMG/M |
3300017727|Ga0181401_1060767 | Not Available | 1014 | Open in IMG/M |
3300017727|Ga0181401_1086220 | Not Available | 811 | Open in IMG/M |
3300017727|Ga0181401_1116953 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 667 | Open in IMG/M |
3300017740|Ga0181418_1112584 | Not Available | 659 | Open in IMG/M |
3300017752|Ga0181400_1052815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 1256 | Open in IMG/M |
3300017762|Ga0181422_1044956 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1424 | Open in IMG/M |
3300017770|Ga0187217_1171437 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 722 | Open in IMG/M |
3300017783|Ga0181379_1027989 | Not Available | 2248 | Open in IMG/M |
3300017783|Ga0181379_1156986 | Not Available | 809 | Open in IMG/M |
3300017786|Ga0181424_10050009 | Not Available | 1810 | Open in IMG/M |
3300017786|Ga0181424_10346744 | Not Available | 611 | Open in IMG/M |
3300017950|Ga0181607_10348737 | Not Available | 819 | Open in IMG/M |
3300018036|Ga0181600_10379405 | Not Available | 690 | Open in IMG/M |
3300019098|Ga0188859_1009290 | Not Available | 567 | Open in IMG/M |
3300019098|Ga0188859_1011231 | Not Available | 526 | Open in IMG/M |
3300020166|Ga0206128_1070923 | All Organisms → Viruses | 1602 | Open in IMG/M |
3300020182|Ga0206129_10115960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 1356 | Open in IMG/M |
3300020185|Ga0206131_10001158 | Not Available | 34566 | Open in IMG/M |
3300020185|Ga0206131_10439644 | Not Available | 532 | Open in IMG/M |
3300021375|Ga0213869_10022694 | Not Available | 3518 | Open in IMG/M |
3300021375|Ga0213869_10046930 | Not Available | 2267 | Open in IMG/M |
3300021957|Ga0222717_10014439 | All Organisms → cellular organisms → Bacteria | 5392 | Open in IMG/M |
3300021957|Ga0222717_10038909 | Not Available | 3118 | Open in IMG/M |
3300021957|Ga0222717_10138340 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
3300021957|Ga0222717_10263909 | Not Available | 995 | Open in IMG/M |
3300021957|Ga0222717_10265735 | Not Available | 991 | Open in IMG/M |
3300021957|Ga0222717_10268244 | Not Available | 985 | Open in IMG/M |
3300021957|Ga0222717_10618723 | Not Available | 565 | Open in IMG/M |
3300021957|Ga0222717_10649171 | Not Available | 546 | Open in IMG/M |
3300021957|Ga0222717_10662691 | Not Available | 539 | Open in IMG/M |
3300021958|Ga0222718_10115006 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1565 | Open in IMG/M |
3300021959|Ga0222716_10021194 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 4823 | Open in IMG/M |
3300021959|Ga0222716_10652491 | Not Available | 566 | Open in IMG/M |
3300021960|Ga0222715_10301958 | Not Available | 909 | Open in IMG/M |
3300022053|Ga0212030_1025672 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 808 | Open in IMG/M |
3300022053|Ga0212030_1049899 | Not Available | 594 | Open in IMG/M |
3300022061|Ga0212023_1020224 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 901 | Open in IMG/M |
3300022072|Ga0196889_1099721 | Not Available | 530 | Open in IMG/M |
3300022187|Ga0196899_1188956 | Not Available | 551 | Open in IMG/M |
3300022201|Ga0224503_10188124 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 669 | Open in IMG/M |
3300022218|Ga0224502_10006164 | Not Available | 4354 | Open in IMG/M |
3300022218|Ga0224502_10319350 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 600 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10209128 | Not Available | 645 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10208511 | Not Available | 849 | Open in IMG/M |
(restricted) 3300024059|Ga0255040_10000071 | Not Available | 20517 | Open in IMG/M |
(restricted) 3300024059|Ga0255040_10090374 | Not Available | 1182 | Open in IMG/M |
(restricted) 3300024059|Ga0255040_10139214 | Not Available | 970 | Open in IMG/M |
(restricted) 3300024059|Ga0255040_10406873 | Not Available | 577 | Open in IMG/M |
(restricted) 3300024062|Ga0255039_10000224 | All Organisms → cellular organisms → Bacteria | 18597 | Open in IMG/M |
(restricted) 3300024062|Ga0255039_10215534 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
(restricted) 3300024062|Ga0255039_10297042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Endozoicomonadaceae → Endozoicomonas → unclassified Endozoicomonas → Endozoicomonas sp. SCSIO W0465 | 689 | Open in IMG/M |
3300024228|Ga0228633_1043282 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1158 | Open in IMG/M |
3300024231|Ga0233399_1045854 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1170 | Open in IMG/M |
(restricted) 3300024264|Ga0233444_10024329 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 4174 | Open in IMG/M |
3300024319|Ga0228670_1003975 | All Organisms → cellular organisms → Bacteria | 4863 | Open in IMG/M |
3300024348|Ga0244776_10039501 | Not Available | 3748 | Open in IMG/M |
(restricted) 3300024518|Ga0255048_10127457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 1253 | Open in IMG/M |
(restricted) 3300024518|Ga0255048_10216506 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 933 | Open in IMG/M |
(restricted) 3300024518|Ga0255048_10656610 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Diaspididae → Morganella | 507 | Open in IMG/M |
(restricted) 3300024520|Ga0255047_10003214 | All Organisms → cellular organisms → Bacteria | 10348 | Open in IMG/M |
(restricted) 3300024520|Ga0255047_10566520 | Not Available | 570 | Open in IMG/M |
(restricted) 3300024520|Ga0255047_10664488 | Not Available | 521 | Open in IMG/M |
3300025070|Ga0208667_1000296 | Not Available | 22601 | Open in IMG/M |
3300025070|Ga0208667_1001556 | All Organisms → cellular organisms → Bacteria | 8220 | Open in IMG/M |
3300025070|Ga0208667_1002951 | All Organisms → cellular organisms → Bacteria | 5326 | Open in IMG/M |
3300025085|Ga0208792_1035391 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 977 | Open in IMG/M |
3300025120|Ga0209535_1212586 | Not Available | 529 | Open in IMG/M |
3300025483|Ga0209557_1000969 | All Organisms → cellular organisms → Bacteria | 16355 | Open in IMG/M |
3300025483|Ga0209557_1005790 | All Organisms → cellular organisms → Bacteria | 5363 | Open in IMG/M |
3300025483|Ga0209557_1028652 | Not Available | 1651 | Open in IMG/M |
3300025483|Ga0209557_1104529 | Not Available | 577 | Open in IMG/M |
3300025508|Ga0208148_1106957 | Not Available | 594 | Open in IMG/M |
3300025543|Ga0208303_1001198 | Not Available | 10365 | Open in IMG/M |
3300025543|Ga0208303_1034710 | Not Available | 1317 | Open in IMG/M |
3300025543|Ga0208303_1063949 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 854 | Open in IMG/M |
3300025577|Ga0209304_1002233 | Not Available | 10676 | Open in IMG/M |
3300025577|Ga0209304_1021413 | Not Available | 2049 | Open in IMG/M |
3300025577|Ga0209304_1026255 | Not Available | 1775 | Open in IMG/M |
3300025594|Ga0209094_1098212 | Not Available | 668 | Open in IMG/M |
3300025608|Ga0209654_1101379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Endozoicomonadaceae → Endozoicomonas → unclassified Endozoicomonas → Endozoicomonas sp. SCSIO W0465 | 770 | Open in IMG/M |
3300025617|Ga0209138_1080134 | Not Available | 1023 | Open in IMG/M |
3300025621|Ga0209504_1023936 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 2253 | Open in IMG/M |
3300025621|Ga0209504_1054548 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1203 | Open in IMG/M |
3300025626|Ga0209716_1005904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6510 | Open in IMG/M |
3300025626|Ga0209716_1018325 | Not Available | 2894 | Open in IMG/M |
3300025626|Ga0209716_1041909 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1581 | Open in IMG/M |
3300025641|Ga0209833_1165503 | Not Available | 566 | Open in IMG/M |
3300025652|Ga0208134_1048726 | Not Available | 1359 | Open in IMG/M |
3300025809|Ga0209199_1029918 | Not Available | 3099 | Open in IMG/M |
3300025816|Ga0209193_1029575 | Not Available | 1651 | Open in IMG/M |
3300025816|Ga0209193_1090638 | Not Available | 774 | Open in IMG/M |
3300025832|Ga0209307_1192661 | Not Available | 595 | Open in IMG/M |
3300025870|Ga0209666_1173756 | Not Available | 952 | Open in IMG/M |
3300025870|Ga0209666_1362049 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 551 | Open in IMG/M |
3300025892|Ga0209630_10211074 | Not Available | 936 | Open in IMG/M |
3300027612|Ga0209037_1103228 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 696 | Open in IMG/M |
3300027833|Ga0209092_10000417 | All Organisms → cellular organisms → Bacteria | 41189 | Open in IMG/M |
3300027833|Ga0209092_10012814 | Not Available | 6004 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10029315 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2224 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10014167 | All Organisms → cellular organisms → Bacteria | 2965 | Open in IMG/M |
3300028008|Ga0228674_1167016 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 724 | Open in IMG/M |
3300028008|Ga0228674_1172304 | Not Available | 709 | Open in IMG/M |
3300028133|Ga0228609_1142147 | Not Available | 594 | Open in IMG/M |
3300028133|Ga0228609_1144487 | Not Available | 587 | Open in IMG/M |
3300028416|Ga0228614_1055634 | Not Available | 828 | Open in IMG/M |
3300031539|Ga0307380_10025258 | All Organisms → cellular organisms → Bacteria | 6981 | Open in IMG/M |
3300031539|Ga0307380_10144989 | Not Available | 2367 | Open in IMG/M |
3300031539|Ga0307380_10670047 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 879 | Open in IMG/M |
3300031539|Ga0307380_11403159 | Not Available | 526 | Open in IMG/M |
3300031565|Ga0307379_11143411 | Not Available | 650 | Open in IMG/M |
3300031565|Ga0307379_11479952 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 542 | Open in IMG/M |
3300031566|Ga0307378_11094438 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 640 | Open in IMG/M |
3300031669|Ga0307375_10054500 | All Organisms → cellular organisms → Bacteria | 3046 | Open in IMG/M |
3300031766|Ga0315322_10736162 | Not Available | 616 | Open in IMG/M |
3300032274|Ga0316203_1020948 | Not Available | 1924 | Open in IMG/M |
3300032277|Ga0316202_10267399 | Not Available | 795 | Open in IMG/M |
3300032277|Ga0316202_10376270 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 663 | Open in IMG/M |
3300032277|Ga0316202_10448322 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 605 | Open in IMG/M |
3300034375|Ga0348336_122566 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 828 | Open in IMG/M |
3300034418|Ga0348337_038288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2089 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 15.50% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.00% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.00% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.50% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.50% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 5.50% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.00% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 4.50% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.50% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 4.00% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 4.00% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.00% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 2.00% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.00% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.50% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.50% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.00% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.00% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.00% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 1.00% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.50% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.50% |
Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.50% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.50% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.50% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.50% |
Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.50% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.50% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2236876002 | Marine microbial communities from Columbia River, CM, sample from CR-7km from mouth, GS312-0p8-CR7-chlmax | Environmental | Open in IMG/M |
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007558 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 | Environmental | Open in IMG/M |
3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019098 | Metatranscriptome of marine microbial communities from Baltic Sea - GS684_0p1 | Environmental | Open in IMG/M |
3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
3300024228 | Seawater microbial communities from Monterey Bay, California, United States - 41D | Environmental | Open in IMG/M |
3300024231 | Seawater microbial communities from Monterey Bay, California, United States - 43D | Environmental | Open in IMG/M |
3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
3300024319 | Seawater microbial communities from Monterey Bay, California, United States - 85D | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
3300027612 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
3300028133 | Seawater microbial communities from Monterey Bay, California, United States - 10D | Environmental | Open in IMG/M |
3300028416 | Seawater microbial communities from Monterey Bay, California, United States - 15D | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
none_0721201 | 2236876002 | Marine Estuarine | MTDKEVERMINAAGLIGAIFGFISGAGLMALVGIIF |
DelMOSum2010_100258208 | 3300000101 | Marine | MTDKELERMINAAGLIGAIFGFVSGAGLMALVGIIF* |
DelMOSum2010_100477554 | 3300000101 | Marine | MSDKELERMINAAGLIGAIIGFASGAGLMMMVGIIF* |
DelMOSum2010_100578605 | 3300000101 | Marine | MDEKEVERMINAAGLIGAVLGFVSGAGLMTMVGIIF* |
DelMOSum2010_100720813 | 3300000101 | Marine | MDDKELERMINAAGLIGAIFGFISGAGLMALVGIIF* |
DelMOSum2010_100890812 | 3300000101 | Marine | MTDKELERMINAAGLIGAIFGFISGAGLMALVGIIF* |
DelMOSum2010_101934942 | 3300000101 | Marine | MDDKELERMINAAGLIGAILGFISGAGLMALVGIIF* |
DelMOSum2011_1000519211 | 3300000115 | Marine | MSDKELERMINAAGLIGAVFGFISGAGLMMMVGIIF* |
DelMOSum2011_100841673 | 3300000115 | Marine | MDDKELERMINAAGLIGAIFGFVSGAGLMALVGIIF* |
DelMOSpr2010_102528191 | 3300000116 | Marine | MTDKEVERMINAAGLIGAIFGFISGAGLMALVGIIF* |
OpTDRAFT_101660582 | 3300000928 | Freshwater And Marine | MEDKEMERMINAAGLIGAIFGFVSGAGLMALVGIIF* |
OpTDRAFT_101681253 | 3300000928 | Freshwater And Marine | MDDKEMERMINAAGFIGAIFGFFSGAVLMALAFVIF* |
BBAY93_101332082 | 3300000973 | Macroalgal Surface | MDDKEKERMINAAGLIGAIFGFISGAGLMAMVGIIF* |
JGI20152J14361_100385862 | 3300001344 | Pelagic Marine | MTDKELERMINAAGLIGAIFGFISGAGLMMLVAIIF* |
JGI20151J14362_100209803 | 3300001346 | Pelagic Marine | MNDKEVERMINAAGLIGAIFGFISGAGLMALVGIIF* |
JGI20151J14362_101670992 | 3300001346 | Pelagic Marine | MNDKELERMINAAGLIGAIFGFISGAGLMAMVGIIF* |
JGI20160J14292_100059375 | 3300001349 | Pelagic Marine | MDDKELERMINAAGLIGAVFGFASGAGLMMLVGIIF* |
JGI20160J14292_101799401 | 3300001349 | Pelagic Marine | MTDKELERMINAAGMIGAIFGFISGAGLMMLVAIIF* |
JGI20157J14317_100704342 | 3300001352 | Pelagic Marine | MNDKELERMINAAGLIGVIFGFISGAGLMMLVAIIF* |
JGI20157J14317_101183652 | 3300001352 | Pelagic Marine | MSDKELERMINAAGLIGAIFGFISGAGLMMLVAIIF* |
Ga0070729_107556082 | 3300005589 | Marine Sediment | MDEKEVERMINAAGLIGALLGFVSGAGLMTMVGIIF* |
Ga0070726_104403082 | 3300005600 | Marine Sediment | MEEKEVERMINAAGFIGAVVGFFSGAVLMALAFTIF* |
Ga0076924_10529592 | 3300005747 | Marine | MDEKELERMINAAGFIGAVIGFFSGAVLMALAFTIF* |
Ga0078893_147163701 | 3300005837 | Marine Surface Water | MGEKELERMINAAGFIGAVIGFFSGAVLMALAFTIF* |
Ga0075474_100518322 | 3300006025 | Aqueous | MDDKEVERMINAAGLIGAIIGFISGAGLMAMVGIIF* |
Ga0075478_100908031 | 3300006026 | Aqueous | MDDKEVERMINAAGLIGAIFGFISGAGLMALVGIIF* |
Ga0075466_10899163 | 3300006029 | Aqueous | MDDKELERMINAAGLIGAIFGFISGAGFMALVGIIF* |
Ga0075466_11316932 | 3300006029 | Aqueous | MDDKEIERMINAAGLIGAIIGFISGAGLMMMVGIIF* |
Ga0098048_100428811 | 3300006752 | Marine | MDDKEVERMINAAGLIGAIIGFISGVSLMTLVAIIF* |
Ga0098048_10138998 | 3300006752 | Marine | MDDKEIERMINAAGFIGAVFGFFSGALLMALAFVIF* |
Ga0098048_10591272 | 3300006752 | Marine | MMQDKEMERMINAAGLIGAIFGFVSGAGLMALVGIIF* |
Ga0098048_10602732 | 3300006752 | Marine | MEDKEIERMINAAGLIGAIFGFVSGAGLMMLVGIIF* |
Ga0098055_10257848 | 3300006793 | Marine | MMQDKEMERMINAAGLIGAIFGFVSGAGLMTLVAIIF* |
Ga0098055_11928552 | 3300006793 | Marine | MDEKEVERMINAAGFIGAVIGFFSGAVLMALAFIIF* |
Ga0075467_101303712 | 3300006803 | Aqueous | MTDEELERMINAAGLIGAIFGFISGAGLMALVGIIF* |
Ga0070754_104015501 | 3300006810 | Aqueous | MTDEELERMINAAGLIGAIFGFISGAGLMMLVAIIF* |
Ga0075476_100062431 | 3300006867 | Aqueous | MDDKEVERMINAAGLIGAIFGFISGAGFMALVGIIF* |
Ga0075476_102400932 | 3300006867 | Aqueous | IVMDDKEVERMINAAGLIGAIIGFISGAGLMAMVGIIF* |
Ga0070750_103281082 | 3300006916 | Aqueous | MMTDKEVERMINAAGLIGAIFGFISGAGLMALVGIIF* |
Ga0098046_10860282 | 3300006990 | Marine | MDDKEIERMINAAGLIGAIFGFVAGAGLMALVGIYFNKNPRSLRY |
Ga0070747_10705765 | 3300007276 | Aqueous | MTDEELERMINAAGLIGAIFGFISGAGLMTLVGIIF* |
Ga0070747_12943792 | 3300007276 | Aqueous | MDDKEVERMINAAGLIGAIFGFASGAGLMMLVGIIF* |
Ga0099847_10109493 | 3300007540 | Aqueous | MDEKELERMINAAGFIGAVIGFFSGAVLTALAFTIF* |
Ga0099847_10488483 | 3300007540 | Aqueous | MTDEEVERMINAAGLIGAIFGFASGAGLMALVAIIF* |
Ga0099847_11649761 | 3300007540 | Aqueous | MTDKELERMINAAGLIGAFVGFFSGAVLMALAFTIF* |
Ga0102822_10407861 | 3300007558 | Estuarine | MEDKEMERMINAAGLIGAIFGFVAGAGLMALVGIIF* |
Ga0102954_12319741 | 3300007778 | Water | MNDKELERMINAAGLIGAIFGFASGAGLMMLVAIIF* |
Ga0102811_12457941 | 3300009024 | Estuarine | MDDKEMERMINAAGLVGAVFGFVSGAGLMAMVGIMF* |
Ga0115549_10065927 | 3300009074 | Pelagic Marine | MDDKEIERMINAAGLIGAIIGFISGAGLMAMVGIIF* |
Ga0115549_10836873 | 3300009074 | Pelagic Marine | VMTDKELERMINAAGLIGAIFGFISGAGLMMLVAIIF* |
Ga0115549_11829042 | 3300009074 | Pelagic Marine | MEDKEMERMINAAGLIGAIFGFVSGAGLMTLVGIIF* |
Ga0115549_12787182 | 3300009074 | Pelagic Marine | MNDKELERMINAAGLIGAIFGFISGAGLMALVGIIF* |
Ga0115550_100765210 | 3300009076 | Pelagic Marine | MSDKELERMINAAGLIGAIIGFASGAGLMMMVGIIFRCRVGGR* |
Ga0115550_10716154 | 3300009076 | Pelagic Marine | MDDKEIERMINAAGLIGAIIGFASGAGLMMLVGIIF* |
Ga0115550_10904443 | 3300009076 | Pelagic Marine | MDDKELERMINAAGLIGAIFGFASGAGLMMLVGIIF* |
Ga0115552_10670272 | 3300009077 | Pelagic Marine | MNDKELERMINAAGLIGAIFGFISGAGLMMLVAIIF* |
Ga0102814_103381802 | 3300009079 | Estuarine | MDDKEVERMINAAGLIGAISGFVAGAGLMAAVGIIF* |
Ga0102812_101587124 | 3300009086 | Estuarine | MDDKEVERMINAAGLIGAVIGFFSGAVLMALVFIIF* |
Ga0102812_104206322 | 3300009086 | Estuarine | MEDKEMERMINAAGLIGAIFGFVAGAGLMTLVGIIF* |
Ga0115548_10362755 | 3300009423 | Pelagic Marine | DKELERMINAAGLIGAIFGFISGAGLMALVGIIF* |
Ga0115545_10940151 | 3300009433 | Pelagic Marine | MDDKEIERMINAAGLIGAIIGFASGAGLMMMVGIIF* |
Ga0115546_11930302 | 3300009435 | Pelagic Marine | MTDKELERMINAAGLIGAIFGFISGAGLMMLVGIIF* |
Ga0115008_101644252 | 3300009436 | Marine | MDEKEVERMINAAGLIGAVFGFVSGAGLMTMVGIIF* |
Ga0115559_10287351 | 3300009438 | Pelagic Marine | MTDKELERMINAAGLIGAIFGFASGAGLMMLVAIIF* |
Ga0115557_11004171 | 3300009443 | Pelagic Marine | MSDKELERMVNAAGLIGAIFGFISGAGLMMLVAIIF* |
Ga0115557_12609031 | 3300009443 | Pelagic Marine | MDDKELGRMINAAGLIGAIFGFISGAGLMALVGII |
Ga0115565_101377992 | 3300009467 | Pelagic Marine | MDEKELERMINAAGLIGAFIGFFSGAVLMALAFTIF* |
Ga0115554_12352152 | 3300009472 | Pelagic Marine | MDDKEVERMINGAGLIGAIFGFISGAGLMALVGIIF* |
Ga0115570_102321963 | 3300009496 | Pelagic Marine | MDEKELERMINAAGFIGAVIGFFSGAGLMALVGIIF* |
Ga0098049_10062382 | 3300010149 | Marine | MDDKEIERMINAAGLIGAIFGFVAGAGLMALVGIIF* |
Ga0098049_11129182 | 3300010149 | Marine | MEDKEIERMINAAGLIGAIFGFVAGAGLMALVGIIF* |
Ga0114922_106381351 | 3300011118 | Deep Subsurface | MNDKELERMINAAGLIGAIFGFISGAGLMALVGII |
Ga0151677_10033597 | 3300011258 | Marine | MEDKEMERMINAAGLIGAIFGFVSGAGLMMLVGIIF* |
Ga0129327_100779872 | 3300013010 | Freshwater To Marine Saline Gradient | MDEKELERMINAAGFIGAVIGFFSGAVLMALVFTIF* |
Ga0129327_102865443 | 3300013010 | Freshwater To Marine Saline Gradient | MDDKEIERMINAAGLIGAIIGFISGAGLMALVGIIF* |
Ga0129327_106569012 | 3300013010 | Freshwater To Marine Saline Gradient | MDDKEVERMINAAGLIGAIFGFVSGAGLMALVGIIF* |
Ga0181391_11381232 | 3300017713 | Seawater | MSDKEIERMINAAGLIGAIFGFVAGAGLMTLVGIIF |
Ga0181373_10139481 | 3300017721 | Marine | MDDKEIERMINAAGLIGAIIGFISGAGLMTLVAIIF |
Ga0181373_10147603 | 3300017721 | Marine | MSDKELERMINAAGLIGAVFGFISGAGLMMLVGIIF |
Ga0181373_10871341 | 3300017721 | Marine | IVMDDKEIERMINAAGLIGAIIGFISGVSLMTLVAIIF |
Ga0181401_10607672 | 3300017727 | Seawater | MDDKEVERMINAAGLIGAVFGFVSGAGLMAMVGVIF |
Ga0181401_10862202 | 3300017727 | Seawater | MDDKEIERMINAAGLIGAIFGFVAGAGLMAMVGIIF |
Ga0181401_11169532 | 3300017727 | Seawater | MDDNEVERMINAAGLIGAIIGFISGFSLMTLVAIIF |
Ga0181418_11125841 | 3300017740 | Seawater | MDDKEIERMINAAGFMGAVFGFFSGAVLMALAFTIF |
Ga0181400_10528152 | 3300017752 | Seawater | MSDKEMERMINAAGLIGAIFGFVAGAGLMTLVGIIF |
Ga0181422_10449562 | 3300017762 | Seawater | MDDKEMERMINAAGLIGAIFGFVSGAGLMAMVGIIF |
Ga0187217_11714371 | 3300017770 | Seawater | VVMDDNEVERMINAAGLIGAIIGFISGVSLMALVAIIF |
Ga0181379_10279892 | 3300017783 | Seawater | MEDKDMERMINAAGLIGAIFGFVAGAGLMTLVGIIF |
Ga0181379_11569862 | 3300017783 | Seawater | MDDKEMERMINAAGLIGAIIGFISGVTLMALVAIIF |
Ga0181424_100500092 | 3300017786 | Seawater | MDDKEIERMINAAGLIGAVTGFISGVSLMALVAIIF |
Ga0181424_103467442 | 3300017786 | Seawater | MEDKEIERMINAAGLIGAVFGFVAGSGLMALVGIIF |
Ga0181607_103487372 | 3300017950 | Salt Marsh | MTDKELERMINAAGLIGVIFGFISGAGLMMLVAIIF |
Ga0181600_103794052 | 3300018036 | Salt Marsh | MDDKELERMINAAGLIGAIFGFISGAGLMALVGIIF |
Ga0188859_10092901 | 3300019098 | Freshwater Lake | SVMDEKEVERMINAAGLIGAVFGFASGAGLMMLVGIIF |
Ga0188859_10112312 | 3300019098 | Freshwater Lake | MNDKELERMINAAGLIGAIFGFISGAGLMALVGIIF |
Ga0206128_10709233 | 3300020166 | Seawater | MSDKELERMINAAGLIGAVFGFASGAGLMMLVGIIF |
Ga0206129_101159602 | 3300020182 | Seawater | MTDKELERMINAAGLIGAIFGFISGAGLMMLVAIIF |
Ga0206131_1000115848 | 3300020185 | Seawater | MTDKELERMINAAGLIGAIFGFISGAGLMALVGIIF |
Ga0206131_104396441 | 3300020185 | Seawater | MNDKELERMINAAGLIGAIFGFISGAGLMALVAIIF |
Ga0213869_1002269410 | 3300021375 | Seawater | MDDKEVERMINAAGLIGAIFGFISGAGLMALVGIIF |
Ga0213869_100469304 | 3300021375 | Seawater | MDDKELERMINAAGLIGAIFGFVSGAGLMALVGIIF |
Ga0222717_1001443913 | 3300021957 | Estuarine Water | MDDKEIERMINAAGFIGAVFGFFSGAVLMALAFTIF |
Ga0222717_100389093 | 3300021957 | Estuarine Water | MEDKEMERMINAAGLIGAIFGFVAGAGLMTLVGIIF |
Ga0222717_101383401 | 3300021957 | Estuarine Water | MDDKEIERMINAAGLVGAITGFISGVSLMALVAIIF |
Ga0222717_102639091 | 3300021957 | Estuarine Water | MDEKEMERMINAAGLIGAIIGFISGVSLMALVAIIF |
Ga0222717_102657352 | 3300021957 | Estuarine Water | MDDKEMERMINAAGFIGAIFGFFSGAVLMALAFVIF |
Ga0222717_102682442 | 3300021957 | Estuarine Water | MDDNEVERMINAAGLIGAIIGFISGVSLMTLVAIIF |
Ga0222717_106187231 | 3300021957 | Estuarine Water | MDDKEMERMINAAGLIGAIFGFASGAGLMTMVGIIF |
Ga0222717_106491712 | 3300021957 | Estuarine Water | MEDKEMERMINAAGLIGAIFGFVSGAGLMAMVGIIF |
Ga0222717_106626912 | 3300021957 | Estuarine Water | MDDKEMERMINAAGLIGAIIGFISGAGLMTMVGIIF |
Ga0222718_101150062 | 3300021958 | Estuarine Water | MNDKELERMINAAGLIGAIFGFASGAGLMMLVAIIF |
Ga0222716_100211943 | 3300021959 | Estuarine Water | MDDKEMERMINAAGLVGAVFGFVSGAGLMAMVGIMF |
Ga0222716_106524911 | 3300021959 | Estuarine Water | MDEKEVERMINAAGLIGAIIGFVSGAGLMTMVGIIF |
Ga0222715_103019582 | 3300021960 | Estuarine Water | MDDKEVERMINAAGLIGAIFGFVAGAGLMAAVGIIF |
Ga0212030_10256722 | 3300022053 | Aqueous | MDEKELERMINAAGFIGAVIGFFSGAVLTALAFTIF |
Ga0212030_10498992 | 3300022053 | Aqueous | MDDKEIERMINAAGLIGAIIGFISGAGLMMMVGIIF |
Ga0212023_10202242 | 3300022061 | Aqueous | MDEKELERMINAAGFIGAVIGFFSGAVLMALAFTIF |
Ga0196889_10997212 | 3300022072 | Aqueous | MTDEELERMINAAGLIGAIFGFISGAGLMALVGIIF |
Ga0196899_11889562 | 3300022187 | Aqueous | MSDKELERMINAAGLIGAIIGFASGAGLMMMVGII |
Ga0224503_101881242 | 3300022201 | Sediment | MDDKEIERMINAAGFIGAIFGFVAGAGLMTLVGIIF |
Ga0224502_100061646 | 3300022218 | Sediment | MDDNEVERMINAAGLIGAIIGFISGVSLMALVAIIF |
Ga0224502_103193502 | 3300022218 | Sediment | MQDKEIERMINAAGLIGAIFGFVAGAGLMTLVGIIF |
(restricted) Ga0233411_102091282 | 3300023112 | Seawater | MDDKEIERMINAAGLIGAIFGFVSGAGLMTMVGIIF |
(restricted) Ga0233412_102085112 | 3300023210 | Seawater | MDDKEMERMINAAGLIGAIFGFVSGAGLMTMVGIIF |
(restricted) Ga0255040_1000007110 | 3300024059 | Seawater | MDDKEVERMINAAGLIGAIFGFVSGAGLMAAVGIIF |
(restricted) Ga0255040_100903743 | 3300024059 | Seawater | MDDKEVERMINAAGLIGAIIGFISGAGLMAVVGIIF |
(restricted) Ga0255040_101392142 | 3300024059 | Seawater | MDDKEIERMINAAGLIGAIFGFASGAGMMMLVAIIF |
(restricted) Ga0255040_104068731 | 3300024059 | Seawater | MNDQEIERMINAAGLVGAIFGFISGAGLMAMVGIIF |
(restricted) Ga0255039_1000022422 | 3300024062 | Seawater | MDDKEVERMINAAGLIGAVFGFVAGAGLMAAVGIIF |
(restricted) Ga0255039_102155341 | 3300024062 | Seawater | MDDKEVERMINAAGLIGAIIGFISGVSLMALVAIIF |
(restricted) Ga0255039_102970421 | 3300024062 | Seawater | MDDKELERMINAAGLIGAIFGFVAGAGLMAAVGIIF |
Ga0228633_10432822 | 3300024228 | Seawater | MEDKEMERMINAAGLIGAIFGFVAGAGLMAMVGIIF |
Ga0233399_10458542 | 3300024231 | Seawater | MDDKEIERMINAAGLIGAIFGFVAGAGLMAAVGIIF |
(restricted) Ga0233444_1002432911 | 3300024264 | Seawater | MEDKELERMINAAGLIGAIFGFISGAGLMAAVGIIF |
Ga0228670_100397512 | 3300024319 | Seawater | MTDKEIERMINAAGFIGAVFGFFSGAVLMALAFIIF |
Ga0244776_100395016 | 3300024348 | Estuarine | MDEKEVERMINAAGLIGAIIGFVSGVSLMTLVAIIF |
(restricted) Ga0255048_101274571 | 3300024518 | Seawater | MDDKEVERMINAAGLIGAIFGFVAGAGLMTMVGIIF |
(restricted) Ga0255048_102165061 | 3300024518 | Seawater | MDDKEVERMINAAGLIGAIFGFASGAGLMMLVGIIF |
(restricted) Ga0255048_106566102 | 3300024518 | Seawater | MDDKELERMINAAGLIGAIFGFVAGAGLMTLVGIIF |
(restricted) Ga0255047_1000321414 | 3300024520 | Seawater | MTDKELERMINAAGLIGAIFGFVSGAGLMALVGIIF |
(restricted) Ga0255047_105665202 | 3300024520 | Seawater | MDEKEVERMINAAGLIGAVIGFASGAGLMMLVGIIF |
(restricted) Ga0255047_106644881 | 3300024520 | Seawater | DDKEVERMINAAHLIGTIVGFISGVVLGAALGGIIF |
Ga0208667_100029618 | 3300025070 | Marine | MMQDKEMERMINAAGLIGAIFGFVSGAGLMALVGIIF |
Ga0208667_10015564 | 3300025070 | Marine | MDDKEVERMINAAGLIGAIIGFISGVSLMTLVAIIF |
Ga0208667_10029517 | 3300025070 | Marine | MDDKEIERMINAAGFIGAVFGFFSGALLMALAFVIF |
Ga0208792_10353911 | 3300025085 | Marine | MMQDKEMERMINAAGLIGAIFGFVSGAGLMTLVAIIF |
Ga0209535_12125862 | 3300025120 | Marine | MDDKEIERMINAAGLIGAIFGFVSGAGLMTLVGIIF |
Ga0209557_100096914 | 3300025483 | Marine | MDDKELERMINAAGLIGAVFGFVAGAGLMAMVGIIF |
Ga0209557_10057906 | 3300025483 | Marine | MEDKEMERMINAAGLIGAIFGFVAGAGLMAAVGIIF |
Ga0209557_10286522 | 3300025483 | Marine | MPDKEIERKIHIAGLIGAIFGFVAGAGLMAAVGIIF |
Ga0209557_11045292 | 3300025483 | Marine | MEDKELERMINAAGLIGAIFGFVAGAGLMAAVGIIF |
Ga0208148_11069572 | 3300025508 | Aqueous | MDDKELERMINAAGLIGAIFGFISGAGFMALVGIIF |
Ga0208303_10011982 | 3300025543 | Aqueous | MTDKELERMINAAGLIGAFVGFFSGAVLMALAFTIF |
Ga0208303_10347101 | 3300025543 | Aqueous | MTDEEVERMINAAGLIGAIFGFASGAGLMALVAIIF |
Ga0208303_10639492 | 3300025543 | Aqueous | MDDKEVERMINAAGLIGAIFGFISGAGLMALVAIIF |
Ga0209304_100223314 | 3300025577 | Pelagic Marine | MDDKEIERMINAAGLIGAIIGFISGAGLMAMVGIIF |
Ga0209304_10214133 | 3300025577 | Pelagic Marine | MSDKELERMINAAGLIGAIIGFASGAGLMMMVGIIF |
Ga0209304_10262552 | 3300025577 | Pelagic Marine | MNDKEVERMINAAGLIGAIFGFISGAGLMALVGIIF |
Ga0209094_10982122 | 3300025594 | Pelagic Marine | MEDKEMERMINAAGLIGAIFGFVSGAGLMTLVGIIF |
Ga0209654_11013792 | 3300025608 | Marine | MTDKELERMINAAGLIGAIFGFASGAGLMMLVGIIF |
Ga0209138_10801342 | 3300025617 | Marine | MDEKEVERMINAAGLIGAIIGFVSGAGLMAMVGIIF |
Ga0209504_10239364 | 3300025621 | Pelagic Marine | MDDKEIERMINAAGLIGAIIGFASGAGLMMLVGIIF |
Ga0209504_10545482 | 3300025621 | Pelagic Marine | LMDDKELERMINAAGLIGAIFGFASGAGLMMLVGIIF |
Ga0209716_10059047 | 3300025626 | Pelagic Marine | MTDKELERMINAAGMIGAIFGFISGAGLMMLVAIIF |
Ga0209716_10183255 | 3300025626 | Pelagic Marine | MDDKELERMINAAGLIGAVFGFASGAGLMMLVGIIF |
Ga0209716_10419092 | 3300025626 | Pelagic Marine | MMTDKEVERMINAAGLIGAIFGFISGAGLMALVGIIF |
Ga0209833_11655031 | 3300025641 | Pelagic Marine | MNDKELERMINAAGLIGAIFGFISGAGLMMLVAIIF |
Ga0208134_10487264 | 3300025652 | Aqueous | MSDKELERMINAAGLIGAVFGFISGAGLMMMVGIIF |
Ga0209199_102991810 | 3300025809 | Pelagic Marine | MNDKELERMINAAGLIGVIFGFISGAGLMMLVAIIF |
Ga0209193_10295752 | 3300025816 | Pelagic Marine | MTDKELERMINAAGLIGAIFGFISGAGLMALVAIIF |
Ga0209193_10906381 | 3300025816 | Pelagic Marine | MTDKELERMINAAGLIGALLGFVSGAGLMTMVGIIF |
Ga0209307_11926612 | 3300025832 | Pelagic Marine | MTDKELERMINAAGLIGAIFGFASGAGLMMLVAIIF |
Ga0209666_11737563 | 3300025870 | Marine | MDDKEIERMINAAGLIAAVFGFVSGAGLMMLVGIIF |
Ga0209666_13620492 | 3300025870 | Marine | MDGKEVERMINAAGLIGAVIGFFSGAVLMALVFIIF |
Ga0209630_102110742 | 3300025892 | Pelagic Marine | MNDKELERMINAAGLIGAIFGFISGAGLMAMVGIIF |
Ga0209037_11032282 | 3300027612 | Marine | MDDKEVERMINAAGLIGAIFGFVSGAGLMALVGIIF |
Ga0209092_1000041745 | 3300027833 | Marine | MEEKEVERMINAAGFIGAVVGFFSGAVLMALAFTIF |
Ga0209092_100128148 | 3300027833 | Marine | MDEKEVERMINAAGLIGAVFGFVSGAGLMTMVGIIF |
(restricted) Ga0233415_100293153 | 3300027861 | Seawater | MDDKEMERMINAAGLIGAIFGFVAGAGLMTLVGIIF |
(restricted) Ga0233413_100141672 | 3300027996 | Seawater | MDEKEVERMINAAGLIGAVIGFFSGAVLMALVFIIF |
Ga0228674_11670162 | 3300028008 | Seawater | MQDKEMERMINAAGLIGAIFGFVAGAGLMTLVGIIF |
Ga0228674_11723042 | 3300028008 | Seawater | MEDKEMERMINAAGLIGAIFGFVAGAGLMTLVGVIF |
Ga0228609_11421471 | 3300028133 | Seawater | MDDKELERMINAAGLIGAIFGFASGAGLMMMVAIIF |
Ga0228609_11444871 | 3300028133 | Seawater | RVMDDKEIERMINAAGFIGAVFGFFSGAVLMALAFTIF |
Ga0228614_10556342 | 3300028416 | Seawater | MDEKEVERMINAAGLIGAIIGFISGAGLMMMVGIIF |
Ga0307380_1002525818 | 3300031539 | Soil | MDDKEVERMISAAGLIGAFIGFFSGSVLMALIFTIF |
Ga0307380_101449895 | 3300031539 | Soil | MNDKEIERMINAAGLIGVIIGFVSGVGVLALVAIIF |
Ga0307380_106700472 | 3300031539 | Soil | MDDKEIERMINAAGLIGVIIGFVSGVGVLALLGIIF |
Ga0307380_114031592 | 3300031539 | Soil | MNDKEVERMINAAGLIGAFIGFFSGSVLMALIFTIF |
Ga0307379_111434112 | 3300031565 | Soil | MDDKEIERMINAAGLIGVIIGFVSGVGVLALVAIIF |
Ga0307379_114799522 | 3300031565 | Soil | VMNDKEVERMINAAGLIGAFIGFFSGSVLMALIFTIF |
Ga0307378_110944381 | 3300031566 | Soil | MDDKEIERMINAAGLIGAFIGFFSGSVLMALIFTIF |
Ga0307375_100545005 | 3300031669 | Soil | MTDKEIERMINAAGLIGVIIGFVSGVGVLALLGIIF |
Ga0315322_107361622 | 3300031766 | Seawater | MDDKEVERMINAAGLIGAIIGFVSGAGLMAMVGIIF |
Ga0316203_10209483 | 3300032274 | Microbial Mat | MDDKEIERMINAAGLIGAIFGFASGAGLMMLVAIIF |
Ga0316202_102673991 | 3300032277 | Microbial Mat | MDDKEIERMINAAGLIGAIIGFASGAGLMMMVGIIF |
Ga0316202_103762702 | 3300032277 | Microbial Mat | MDDKELERMINAAGLIGAFVGFFSGAVLMALAFTIF |
Ga0316202_104483222 | 3300032277 | Microbial Mat | LMDDKELERMINAAGLIGAVFGFISGACLMALVGIIF |
Ga0348336_122566_370_480 | 3300034375 | Aqueous | MTDEELERMINAAGLIGAIFGFISGAGLMMLVAIIF |
Ga0348337_038288_1474_1584 | 3300034418 | Aqueous | MTDKEVERMINAAGLIGAIFGFISGAGLMMLVAIIF |
⦗Top⦘ |