NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F030405

Metagenome / Metatranscriptome Family F030405

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F030405
Family Type Metagenome / Metatranscriptome
Number of Sequences 185
Average Sequence Length 39 residues
Representative Sequence RGAMQGYDVVLFILALAKTVTPGGGPRREPGQAAPPTT
Number of Associated Samples 83
Number of Associated Scaffolds 185

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.62 %
% of genes near scaffold ends (potentially truncated) 98.38 %
% of genes from short scaffolds (< 2000 bps) 87.03 %
Associated GOLD sequencing projects 57
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.162 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge
(75.135 % of family members)
Environment Ontology (ENVO) Unclassified
(85.405 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(78.919 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 28.79%    β-sheet: 0.00%    Coil/Unstructured: 71.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 185 Family Scaffolds
PF05016ParE_toxin 4.32
PF00578AhpC-TSA 2.16
PF03544TonB_C 2.16
PF08308PEGA 1.62
PF13905Thioredoxin_8 1.08
PF06940DUF1287 1.08
PF04326AlbA_2 1.08
PF07927HicA_toxin 1.08
PF13470PIN_3 1.08
PF11731Cdd1 1.08
PF14300DUF4375 1.08
PF02493MORN 1.08
PF10077DUF2314 0.54
PF14294DUF4372 0.54
PF13432TPR_16 0.54
PF08906DUF1851 0.54
PF00903Glyoxalase 0.54
PF03781FGE-sulfatase 0.54
PF06054CoiA 0.54
PF05168HEPN 0.54
PF14338Mrr_N 0.54
PF13588HSDR_N_2 0.54
PF01694Rhomboid 0.54
PF13975gag-asp_proteas 0.54
PF03190Thioredox_DsbH 0.54
PF06769YoeB_toxin 0.54
PF14254DUF4348 0.54
PF12675DUF3795 0.54
PF07676PD40 0.54
PF03852Vsr 0.54
PF00480ROK 0.54
PF00079Serpin 0.54
PF13508Acetyltransf_7 0.54
PF13683rve_3 0.54
PF15580Imm53 0.54
PF01934HepT-like 0.54
PF02687FtsX 0.54
PF12950TaqI_C 0.54
PF14289DUF4369 0.54
PF13676TIR_2 0.54
PF11185DUF2971 0.54
PF04402SIMPL 0.54
PF01789PsbP 0.54
PF13495Phage_int_SAM_4 0.54

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 185 Family Scaffolds
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 2.16
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 1.08
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.08
COG2849Antitoxin component YwqK of the YwqJK toxin-antitoxin moduleDefense mechanisms [V] 1.08
COG2865Predicted transcriptional regulator, contains HTH domainTranscription [K] 1.08
COG3738Uncharacterized conserved protein YijF, DUF1287 familyFunction unknown [S] 1.08
COG4642Uncharacterized conserved proteinFunction unknown [S] 1.08
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 0.54
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.54
COG1331Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domainsGeneral function prediction only [R] 0.54
COG1895HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.54
COG2250HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.54
COG2361HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.54
COG2445Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 familyGeneral function prediction only [R] 0.54
COG2859Outer membrane channel-forming protein BP26/OMP28, SIMPL familyCell wall/membrane/envelope biogenesis [M] 0.54
COG2968Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domainFunction unknown [S] 0.54
COG3471Predicted secreted (periplasmic) proteinFunction unknown [S] 0.54
COG3727G:T-mismatch repair DNA endonuclease Vsr, very short patch repair proteinReplication, recombination and repair [L] 0.54
COG4115Toxin component of the Txe-Axe toxin-antitoxin module, Txe/YoeB familyDefense mechanisms [V] 0.54
COG4469Competence protein CoiA, contains predicted nuclease domainGeneral function prediction only [R] 0.54
COG4826Serine protease inhibitorPosttranslational modification, protein turnover, chaperones [O] 0.54
COG5620Uncharacterized conserved protein, DUF1851 domainFunction unknown [S] 0.54

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.24 %
UnclassifiedrootN/A16.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004154|Ga0066603_10193557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium917Open in IMG/M
3300004282|Ga0066599_100565592All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300006651|Ga0101725_112888All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Alkaliflexus → Alkaliflexus imshenetskii870Open in IMG/M
3300006896|Ga0102513_103516All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales2474Open in IMG/M
3300007909|Ga0111548_1020538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium1283Open in IMG/M
3300008948|Ga0116018_1044217Not Available510Open in IMG/M
3300008987|Ga0116022_1000011All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes204401Open in IMG/M
3300009075|Ga0105090_10390112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium849Open in IMG/M
3300009081|Ga0105098_10502115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium618Open in IMG/M
3300009085|Ga0105103_10500446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium682Open in IMG/M
3300009165|Ga0105102_10530815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium642Open in IMG/M
3300009669|Ga0116148_1242033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium762Open in IMG/M
3300009669|Ga0116148_1343554All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia601Open in IMG/M
3300009671|Ga0123334_1165785Not Available1043Open in IMG/M
3300009671|Ga0123334_1227353All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300009671|Ga0123334_1273913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium741Open in IMG/M
3300009675|Ga0116149_1070006All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1948Open in IMG/M
3300009675|Ga0116149_1127302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium1266Open in IMG/M
3300009675|Ga0116149_1214169All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes874Open in IMG/M
3300009680|Ga0123335_1397967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium636Open in IMG/M
3300009687|Ga0116144_10161126All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1223Open in IMG/M
3300009689|Ga0116186_1447304All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300009692|Ga0116171_10065478All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → unclassified Marinilabiliaceae → Marinilabiliaceae bacterium JC0172290Open in IMG/M
3300009692|Ga0116171_10160289All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1300Open in IMG/M
3300009692|Ga0116171_10263590All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Sunxiuqinia → Sunxiuqinia elliptica950Open in IMG/M
3300009692|Ga0116171_10269395All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium937Open in IMG/M
3300009692|Ga0116171_10364356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium776Open in IMG/M
3300009692|Ga0116171_10396685Not Available735Open in IMG/M
3300009692|Ga0116171_10431878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium696Open in IMG/M
3300009692|Ga0116171_10441012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium688Open in IMG/M
3300009693|Ga0116141_10263267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium924Open in IMG/M
3300009693|Ga0116141_10332060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium795Open in IMG/M
3300009694|Ga0116170_10391580All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Mariniphaga → Mariniphaga sediminis763Open in IMG/M
3300009696|Ga0116177_10325254Not Available818Open in IMG/M
3300009696|Ga0116177_10385019All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes740Open in IMG/M
3300009713|Ga0116163_1144215All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes873Open in IMG/M
3300009713|Ga0116163_1204799All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes691Open in IMG/M
3300009771|Ga0116155_10075952Not Available1543Open in IMG/M
3300009771|Ga0116155_10156037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia980Open in IMG/M
3300009771|Ga0116155_10233883Not Available762Open in IMG/M
3300009771|Ga0116155_10265280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Leptolinea → unclassified Leptolinea → Leptolinea sp.706Open in IMG/M
3300009771|Ga0116155_10279927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium683Open in IMG/M
3300009771|Ga0116155_10294049Not Available663Open in IMG/M
3300009771|Ga0116155_10306965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium646Open in IMG/M
3300009772|Ga0116162_10173758All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes936Open in IMG/M
3300009772|Ga0116162_10340318All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium614Open in IMG/M
3300009775|Ga0116164_10182237Not Available944Open in IMG/M
3300009775|Ga0116164_10257491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium753Open in IMG/M
3300009775|Ga0116164_10268635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium733Open in IMG/M
3300009776|Ga0116154_10041814All Organisms → cellular organisms → Bacteria2199Open in IMG/M
3300009776|Ga0116154_10050097All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Mangrovibacterium → Mangrovibacterium diazotrophicum1973Open in IMG/M
3300009776|Ga0116154_10076024All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Imperialibacter1543Open in IMG/M
3300009776|Ga0116154_10205804Not Available859Open in IMG/M
3300009776|Ga0116154_10254625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium759Open in IMG/M
3300009776|Ga0116154_10259097All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium HGW-Bacteroidetes-21751Open in IMG/M
3300009776|Ga0116154_10440613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium555Open in IMG/M
3300009778|Ga0116151_10194509All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flammeovirga → unclassified Flammeovirga → Flammeovirga sp. EKP2021023Open in IMG/M
3300009778|Ga0116151_10322044All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes723Open in IMG/M
3300009779|Ga0116152_10321943All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium743Open in IMG/M
3300009779|Ga0116152_10341420All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Algoriphagus714Open in IMG/M
3300009780|Ga0116156_10285834All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes839Open in IMG/M
3300009781|Ga0116178_10288826All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Ornithobacterium → Ornithobacterium rhinotracheale816Open in IMG/M
3300009781|Ga0116178_10340200All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium739Open in IMG/M
3300009781|Ga0116178_10545648All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium562Open in IMG/M
3300009782|Ga0116157_10145593All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Luteibaculaceae → Luteibaculum → Luteibaculum oceani1353Open in IMG/M
3300009783|Ga0116158_10163655All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. 4G91337Open in IMG/M
3300009783|Ga0116158_10204818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium1152Open in IMG/M
3300009838|Ga0116153_10067378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium1530Open in IMG/M
3300009838|Ga0116153_10160509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium931Open in IMG/M
3300009838|Ga0116153_10267285All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300009838|Ga0116153_10358517All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes596Open in IMG/M
3300009868|Ga0130016_10152425All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1848Open in IMG/M
3300010346|Ga0116239_10045662All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4240Open in IMG/M
3300010346|Ga0116239_10103578All Organisms → cellular organisms → Bacteria2338Open in IMG/M
3300010349|Ga0116240_10104604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2222Open in IMG/M
3300010349|Ga0116240_10669368Not Available676Open in IMG/M
3300010350|Ga0116244_10026185All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia5311Open in IMG/M
3300010350|Ga0116244_10316774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium1058Open in IMG/M
3300010351|Ga0116248_10469282All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes930Open in IMG/M
3300010352|Ga0116247_10138564All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2080Open in IMG/M
3300010352|Ga0116247_10188625All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1720Open in IMG/M
3300010352|Ga0116247_10200499All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1656Open in IMG/M
3300010352|Ga0116247_10363603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium1141Open in IMG/M
3300010352|Ga0116247_10385640All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1100Open in IMG/M
3300010352|Ga0116247_10563359Not Available870Open in IMG/M
3300010352|Ga0116247_10571794Not Available862Open in IMG/M
3300010352|Ga0116247_10908210All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium647Open in IMG/M
3300010352|Ga0116247_11364983Not Available503Open in IMG/M
3300010353|Ga0116236_10123964All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2461Open in IMG/M
3300010353|Ga0116236_10164320All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Marinilabilia → Marinilabilia salmonicolor2051Open in IMG/M
3300010353|Ga0116236_10303534All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1393Open in IMG/M
3300010353|Ga0116236_10803961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium754Open in IMG/M
3300010355|Ga0116242_10498790All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1114Open in IMG/M
3300010356|Ga0116237_10384793All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → unclassified Marinilabiliaceae → Marinilabiliaceae bacterium JC0171251Open in IMG/M
3300010356|Ga0116237_10546348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium1009Open in IMG/M
3300010356|Ga0116237_11500341All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300010357|Ga0116249_10084612All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3023Open in IMG/M
3300010357|Ga0116249_10254498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium1627Open in IMG/M
3300010357|Ga0116249_10597393All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1012Open in IMG/M
3300010357|Ga0116249_10645818Not Available969Open in IMG/M
3300010357|Ga0116249_10726669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium907Open in IMG/M
3300010357|Ga0116249_10886030Not Available810Open in IMG/M
3300010357|Ga0116249_11009466All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes752Open in IMG/M
3300010357|Ga0116249_11285304Not Available655Open in IMG/M
3300010357|Ga0116249_11387662Not Available627Open in IMG/M
3300010357|Ga0116249_11976708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium511Open in IMG/M
3300010429|Ga0116241_10145124All Organisms → cellular organisms → Bacteria2005Open in IMG/M
3300010429|Ga0116241_10465121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium993Open in IMG/M
3300010429|Ga0116241_10489898All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon M8B2D963Open in IMG/M
3300010429|Ga0116241_10528476All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes921Open in IMG/M
3300010429|Ga0116241_10656827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium811Open in IMG/M
3300010429|Ga0116241_10708541All Organisms → cellular organisms → Bacteria → Caldiserica/Cryosericota group → Caldiserica → Caldisericia → Caldisericales → unclassified Caldisericales → Caldisericales bacterium775Open in IMG/M
3300010429|Ga0116241_10713261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium772Open in IMG/M
3300010429|Ga0116241_10845796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium700Open in IMG/M
3300010429|Ga0116241_10880723All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Mangrovibacterium → Mangrovibacterium diazotrophicum683Open in IMG/M
3300010429|Ga0116241_11454605Not Available512Open in IMG/M
(restricted) 3300013127|Ga0172365_10601295Not Available629Open in IMG/M
3300014255|Ga0075320_1085340Not Available608Open in IMG/M
3300014258|Ga0075315_1079052Not Available595Open in IMG/M
3300019231|Ga0179935_1303285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes683Open in IMG/M
3300020814|Ga0214088_1141859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium938Open in IMG/M
3300020814|Ga0214088_1444544Not Available922Open in IMG/M
3300021603|Ga0226659_10256368All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → Fibrobacteria → Fibrobacterales → Fibrobacteraceae → Fibrobacter → unclassified Fibrobacter → Fibrobacter sp.797Open in IMG/M
3300021603|Ga0226659_10263064All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Sunxiuqinia → Sunxiuqinia dokdonensis784Open in IMG/M
3300021603|Ga0226659_10354834Not Available648Open in IMG/M
3300025563|Ga0210112_1096262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum609Open in IMG/M
3300025611|Ga0209408_1014072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2928Open in IMG/M
3300025611|Ga0209408_1021338All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2181Open in IMG/M
3300025611|Ga0209408_1081853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes875Open in IMG/M
3300025611|Ga0209408_1100161All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes764Open in IMG/M
3300025702|Ga0209203_1111745All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300025702|Ga0209203_1148864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium735Open in IMG/M
3300025702|Ga0209203_1242813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium521Open in IMG/M
3300025706|Ga0209507_1085610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium898Open in IMG/M
3300025708|Ga0209201_1020748All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia3390Open in IMG/M
3300025715|Ga0209310_1130448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium749Open in IMG/M
3300025715|Ga0209310_1173759Not Available622Open in IMG/M
3300025847|Ga0209607_1029801All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3000Open in IMG/M
3300025855|Ga0209717_1036680All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2533Open in IMG/M
3300025856|Ga0209604_1137535All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae1038Open in IMG/M
3300025856|Ga0209604_1216177Not Available753Open in IMG/M
3300025856|Ga0209604_1238481Not Available701Open in IMG/M
3300025858|Ga0209099_1048259All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2105Open in IMG/M
3300025858|Ga0209099_1147424All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium958Open in IMG/M
3300025858|Ga0209099_1236862All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Sunxiuqinia → Sunxiuqinia dokdonensis685Open in IMG/M
3300025859|Ga0209096_1192527All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes776Open in IMG/M
3300025861|Ga0209605_1010371All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5967Open in IMG/M
3300025867|Ga0209098_1096800Not Available1363Open in IMG/M
3300025867|Ga0209098_1153208All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300025867|Ga0209098_1275119All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae657Open in IMG/M
3300025871|Ga0209311_1130691All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1070Open in IMG/M
3300025871|Ga0209311_1238050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Flexilinea → Flexilinea flocculi709Open in IMG/M
3300025877|Ga0208460_10175704All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales840Open in IMG/M
3300025902|Ga0209202_1028509All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin0082271Open in IMG/M
3300025902|Ga0209202_1031171All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2137Open in IMG/M
3300025902|Ga0209202_1070008All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1211Open in IMG/M
3300025902|Ga0209202_1104972All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes903Open in IMG/M
3300025902|Ga0209202_1120531All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes816Open in IMG/M
3300025902|Ga0209202_1147277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium705Open in IMG/M
3300025902|Ga0209202_1186917All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300026290|Ga0209510_1062596All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1503Open in IMG/M
3300026290|Ga0209510_1097923Not Available1063Open in IMG/M
3300026311|Ga0209723_1319379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium511Open in IMG/M
3300027719|Ga0209467_1205058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes686Open in IMG/M
3300027719|Ga0209467_1257539Not Available591Open in IMG/M
3300027721|Ga0209492_1208178All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300027739|Ga0209575_10075052All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon M8B2D1235Open in IMG/M
3300027739|Ga0209575_10168055All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes786Open in IMG/M
3300027796|Ga0209373_10286838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium674Open in IMG/M
3300027800|Ga0209800_10076253All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1545Open in IMG/M
3300027800|Ga0209800_10333819All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes632Open in IMG/M
3300027972|Ga0209079_10259434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium591Open in IMG/M
3300027975|Ga0209391_10182452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium880Open in IMG/M
3300028849|Ga0307352_105243All Organisms → cellular organisms → Bacteria1401Open in IMG/M
3300028850|Ga0307358_101474All Organisms → cellular organisms → Bacteria → Terrabacteria group2699Open in IMG/M
3300028850|Ga0307358_110539All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales1013Open in IMG/M
3300029797|Ga0243129_1014727All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3172Open in IMG/M
3300029797|Ga0243129_1056138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium1343Open in IMG/M
3300029797|Ga0243129_1143617Not Available650Open in IMG/M
3300029799|Ga0311022_10507187All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1192Open in IMG/M
3300029834|Ga0307324_102143All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1754Open in IMG/M
3300029942|Ga0168096_1025066All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Dysgonomonadaceae → Dysgonomonas1424Open in IMG/M
3300033434|Ga0316613_10301883All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300033434|Ga0316613_11220644Not Available518Open in IMG/M
3300033757|Ga0373404_0239183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium545Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge75.14%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater4.86%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.78%
Anaerobic Biogas ReactorEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor3.78%
Granular SludgeEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge2.70%
SedimentEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sediment1.62%
SedimentEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment1.08%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.08%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.08%
Oil SandsEnvironmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands1.08%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.54%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.54%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.54%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.54%
BiosolidsEngineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids0.54%
Anaerobic Digester DigestateEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate0.54%
Anaerobic Digester LeachateEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Leachate0.54%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004154Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300006651T8 (1) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 timesEnvironmentalOpen in IMG/M
3300006896Final time point T34 (3) (BES) benzoate enrichments of Methanogenic microbial communities using Athabasca oil sands as inoculumEnvironmentalOpen in IMG/M
3300007909Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_686d_2EnvironmentalOpen in IMG/M
3300008948Combined Assembly of De NOVO T10 (BES) Tyne Sediment Benzoate Gp0125656, Gp0125657, Gp0125121EnvironmentalOpen in IMG/M
3300008987Combined Assembly of De NOVO T34 (live) FTP Oil sands Benzoate Gp0125668, Gp0125720, Gp0125669EnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009669Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaGEngineeredOpen in IMG/M
3300009671Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNAEngineeredOpen in IMG/M
3300009675Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaGEngineeredOpen in IMG/M
3300009680Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNAEngineeredOpen in IMG/M
3300009687Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaGEngineeredOpen in IMG/M
3300009689Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaGEngineeredOpen in IMG/M
3300009692Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaGEngineeredOpen in IMG/M
3300009693Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaGEngineeredOpen in IMG/M
3300009694Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaGEngineeredOpen in IMG/M
3300009696Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaGEngineeredOpen in IMG/M
3300009713Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaGEngineeredOpen in IMG/M
3300009771Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaGEngineeredOpen in IMG/M
3300009772Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC105_MetaGEngineeredOpen in IMG/M
3300009775Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaGEngineeredOpen in IMG/M
3300009776Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaGEngineeredOpen in IMG/M
3300009778Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaGEngineeredOpen in IMG/M
3300009779Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC119_MetaGEngineeredOpen in IMG/M
3300009780Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaGEngineeredOpen in IMG/M
3300009781Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaGEngineeredOpen in IMG/M
3300009782Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaGEngineeredOpen in IMG/M
3300009783Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaGEngineeredOpen in IMG/M
3300009838Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaGEngineeredOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300010346AD_USMOcaEngineeredOpen in IMG/M
3300010349AD_HKTAcaEngineeredOpen in IMG/M
3300010350AD_HKSTcaEngineeredOpen in IMG/M
3300010351AD_USPNcaEngineeredOpen in IMG/M
3300010352AD_JPHWcaEngineeredOpen in IMG/M
3300010353AD_USCAcaEngineeredOpen in IMG/M
3300010355AD_USDVcaEngineeredOpen in IMG/M
3300010356AD_USDEcaEngineeredOpen in IMG/M
3300010357AD_USSTcaEngineeredOpen in IMG/M
3300010429AD_USRAcaEngineeredOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300014255Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2EnvironmentalOpen in IMG/M
3300014258Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D1EnvironmentalOpen in IMG/M
3300019231Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300020814Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahitEngineeredOpen in IMG/M
3300021603Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spadesEngineeredOpen in IMG/M
3300025563Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025611Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025702Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025706Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025708Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025715Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025847Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025855Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025856Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025858Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025859Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025861Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025867Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025871Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025877Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025902Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG (SPAdes)EngineeredOpen in IMG/M
3300026290Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA (SPAdes)EngineeredOpen in IMG/M
3300026311Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes)EngineeredOpen in IMG/M
3300027719Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027739Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027796Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 (SPAdes)EnvironmentalOpen in IMG/M
3300027800Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027975Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028849Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Thr1 (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300028850Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Leu1 (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300029797Sediment microbial communities from Yellow Sea, Weihai, China - HGD.2EnvironmentalOpen in IMG/M
3300029799Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119EngineeredOpen in IMG/M
3300029834Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Gly1 (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300029942Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP8 - Uppsala-digested 109EngineeredOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033757Leachate microbial community from anaerobic digester in University of Toronto, Ontario, Canada - S62W2 SPEngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Ga0066603_1019355713300004154FreshwaterVGVFLHRGAMQGYDVVLFILALAKTVTPAGAGAAAPPTT*
Ga0066599_10056559223300004282FreshwaterMKGYEVVLFILALAKTPDKSGQAVTPQGSLRREPGLAAPPAT*
Ga0101725_11288813300006651SedimentFCTRGAMQGYDGYFFILALAKTVTPGGSPRREPGRPAPRW*
Ga0102513_10351633300006896Oil SandsACFCTRGAVQDYDGYYFILAMAKTVTPGGSPRREPGQAAPPTT*
Ga0111548_102053833300007909SedimentDAMQGYDVVLFILALAKTVTPGGSPRREPGRAVPLTT*
Ga0116018_104421713300008948SedimentLQDYDVDLFILALAKTVTPGGGPRREPGQAAPPTT*
Ga0116022_10000111703300008987Oil SandsMHRGGGACFCTRGAVQDYDGYYFILAMAKTVTPGGSPRREPGQAAPPTT*
Ga0105090_1039011223300009075Freshwater SedimentGCFCTRGAMQGYDCYYFILALAKTVTPAGGPWREPGRAVAPATELPL*
Ga0105098_1050211523300009081Freshwater SedimentPQLRGGARFCTRGAKQDYDVVLNIVALAKTVTPAGGPRREPGQAAPLTT*
Ga0105103_1050044623300009085Freshwater SedimentCTRGAIQGYDVVLSIVALAKTVTPGGSPRREPGQAAPLTT*
Ga0105102_1053081523300009165Freshwater SedimentGAMQGYDVVLFILALAKTVTPAGSPRREPGQAAPPAT*
Ga0116148_124203313300009669Anaerobic Digestor SludgeMQGYDVDLFILALAKTVTPGGSPRREPGRAVAPATKPSL*
Ga0116148_134355433300009669Anaerobic Digestor SludgeFCTRGAMQDYDVVLLILALAKTVTPPGGPRREPGQAAPPTT*
Ga0123334_116578543300009671Anaerobic Biogas ReactorFCTRGAMQGYDGYYLILALAKTVTPGGSPRREPGQAAPPTT*
Ga0123334_122735313300009671Anaerobic Biogas ReactorMQDYDVVLFVLALAKTVTPGGGPRREPGQAVALATKPLH*
Ga0123334_127391323300009671Anaerobic Biogas ReactorGAMQDYDVYLFVLALAKTVTPGGGPRREPGQAAPPTT*
Ga0116149_107000633300009675Anaerobic Digestor SludgeVQGYDVVLFILALAKTVTPGGGPRREPGQAAPLTT*
Ga0116149_112730233300009675Anaerobic Digestor SludgeFCTRGAMQGYDVDLFILALAKTVTPGGGPRREPGRAVPLTT*
Ga0116149_121416913300009675Anaerobic Digestor SludgeRGGARFCTRGAMKGYDGYYFVLALAKTVTPGGSPRREPGQAVAQATKPPI*
Ga0123335_139796713300009680Anaerobic Biogas ReactorMQDYDGYLFILALAKTVTPGGGPRREPGRPAPPLKV
Ga0116144_1016112623300009687Anaerobic Digestor SludgeCFCTRGAMQDYDVYLFVLALAKTVTPEGGPRREPGQPVPPTTEQSN*
Ga0116186_144730413300009689Anaerobic Digestor SludgeQGYDVVLFILALAKTVTAAGGPRREPGRAVAPATKPPL*
Ga0116171_1006547833300009692Anaerobic Digestor SludgeRGAMQGYDGYYFILALAKTVTPGGSPRREPGQAAPLTT*
Ga0116171_1016028923300009692Anaerobic Digestor SludgeARFCTRGAMQGYDVDLFIVALAKTVTPGGGPRREPGQAAPPTT*
Ga0116171_1026359013300009692Anaerobic Digestor SludgeGAMQGYDGYYFILALAKTVTPGGSPRREPGQAAPPTT*
Ga0116171_1026939533300009692Anaerobic Digestor SludgeRGAMQDYDIVLIIVTLAKTVTPGGSPRREPGQAVPPTT*
Ga0116171_1036435623300009692Anaerobic Digestor SludgeGAMQGYDVVLYIIALAKTVTPGGSPRREPGQAVPPTT*
Ga0116171_1039668523300009692Anaerobic Digestor SludgeCTRGAMQSYDVDLFIVALAKTVTPPGSPRREPGRAAPPTT*
Ga0116171_1043187823300009692Anaerobic Digestor SludgeMQDYDVDLFIIALAKTVTPGGGPRRQPGQAVPPAT*
Ga0116171_1044101223300009692Anaerobic Digestor SludgeRGAMWDYDFVLFILALAKTVTPEGSPRREPGRAAPPTT*
Ga0116141_1026326723300009693Anaerobic Digestor SludgeGAMQGYDVVLFILALAKTVTPGGGPRREPGQAAPPTT*
Ga0116141_1033206023300009693Anaerobic Digestor SludgeRDAMQGYDVVLFVLALAKTVTPGGSPRREPGQAAPLTT*
Ga0116170_1039158013300009694Anaerobic Digestor SludgeRGAMQGYDVVLFIVALAKTVTPGGSAPRERGRAAPLTT*
Ga0116177_1032525423300009696Anaerobic Digestor SludgeYDVVLFIVALAKTVTPAGGPRREPGQAVAPATKPPL*
Ga0116177_1038501913300009696Anaerobic Digestor SludgeGYDGYYFILALAKTVTPGGGPRRKPGRAVAPATKPPL*
Ga0116163_114421513300009713Anaerobic Digestor SludgeGAMQGYDVVLFILALAKTVTPGGSAPRERGRAAPPTT*
Ga0116163_120479913300009713Anaerobic Digestor SludgeLSIVALAKTVTPRGSPRREPGQAAPLTTNRSSLA*
Ga0116155_1007595223300009771Anaerobic Digestor SludgeGACFCTRGAMQDYDGYYFILALAKTVTPGGSPRREPGQAAPLTT*
Ga0116155_1015603723300009771Anaerobic Digestor SludgeQGYDDVLFILALAKTVTPRGSPRREPGQAAPPTT*
Ga0116155_1023388323300009771Anaerobic Digestor SludgeCTRGAMQGYDVDLFILALAKTVTPGGGPRREPGQAAPPTT*
Ga0116155_1026528013300009771Anaerobic Digestor SludgeMQGYDVVLFIVALVRTETPGGSPPRKPGWAVALATKHSSLV
Ga0116155_1027992733300009771Anaerobic Digestor SludgeCTRGAEQGYDGYYFILALAKTVTPGGSAPRERGRAAPPTT*
Ga0116155_1029404913300009771Anaerobic Digestor SludgeGAMPGYEVDLFILALAKTVTPPGGHRREPGQAVPQTT*
Ga0116155_1030696513300009771Anaerobic Digestor SludgeFCTRGAMRDYDVVLFIVALAKTVTPGGSPRREPGQAAPLAT*
Ga0116162_1017375833300009772Anaerobic Digestor SludgeCTRGAMQGYDVVLFILALAKTVTPGGGPRRKPGQAAPQTT*
Ga0116162_1034031823300009772Anaerobic Digestor SludgeGAMQGYDVVLFILALAKTVTPGGSPRRKPGRAAPLTTK*
Ga0116164_1018223723300009775Anaerobic Digestor SludgeMRDYDVYLFILALAKTVTPPGSPRREPGQAAPPIP*
Ga0116164_1025749123300009775Anaerobic Digestor SludgeAMQGYDVDLFVLALAKTVTPGGGPRREPGRAVAPATKPPL*
Ga0116164_1026863513300009775Anaerobic Digestor SludgeGARFCTRGAMQDYDVVLSILALAKTVTPGGSPRREPGRAAPPTT*
Ga0116154_1004181433300009776Anaerobic Digestor SludgeGAMQGYDVVLFILALAKTVTPPGSPRREPGRAVPPTT*
Ga0116154_1005009733300009776Anaerobic Digestor SludgeGAMQGYDVVLFIVALAKTVTPGGGPRREPGQAAPSTT*
Ga0116154_1007602433300009776Anaerobic Digestor SludgeGAMQGYDVILFILALAKTVTPLGGPRREPGQAVPPTT*
Ga0116154_1020580413300009776Anaerobic Digestor SludgeQGYYVVLFIVAVAKTVTPIGGPRREPGQAAPPTT*
Ga0116154_1025462513300009776Anaerobic Digestor SludgeTCFCTRGAIQGYDVVWFIVALAKTVTPGGGPRREPGRAAPPTT*
Ga0116154_1025909723300009776Anaerobic Digestor SludgeCTRGAMQDYDVVLFILALAKTVTPRGGPRREPGRAAPLTT*
Ga0116154_1044061323300009776Anaerobic Digestor SludgeYDVDLFILALAKTVTPGGSPRREPGQAAPLTTNGPL*
Ga0116151_1019450923300009778Anaerobic Digestor SludgeQDYDVVLFVLALAKTVTPGGGPRREPGQAAPHTT*
Ga0116151_1032204413300009778Anaerobic Digestor SludgeGAMQGYDVVLFILAMAKTVTPAGGPRREPGRAVALATKPPL*
Ga0116152_1032194323300009779Anaerobic Digestor SludgeMQGYDVVLSILALAKTVTPGGSPRREPGQAAPLAT*
Ga0116152_1034142013300009779Anaerobic Digestor SludgeRGAMQGYDVVLFILALAKTVTPGGSPRREPGRAAPPAT*
Ga0116156_1028583423300009780Anaerobic Digestor SludgeCTRGAMQDYDVYLFVLALAKTVTPEGGPRREPGQPVPPTTEQSN*
Ga0116178_1028882623300009781Anaerobic Digestor SludgeMQGYDVVLFIIALAKTVTPAGGPRREPGRAVAPATKPPL*
Ga0116178_1034020013300009781Anaerobic Digestor SludgeFCTRGAMQDYDVVLFIIALAKTVTPGGSPRREPGQAVPLTT*
Ga0116178_1054564813300009781Anaerobic Digestor SludgeQDYDVDLFILALAKTVTPGGSPRREPGRAAPPTT*
Ga0116157_1014559333300009782Anaerobic Digestor SludgeCTRGAMQDYDVVLSILALAKTVTPGGSPRREPGRAAPPTT*
Ga0116158_1016365543300009783Anaerobic Digestor SludgeTRGAMQVYDGYYLILALAKTVTPGGGPRREPGQAAPPTT*
Ga0116158_1020481823300009783Anaerobic Digestor SludgeQGYDVVLFILALAKTVTPGGGPRREPGRAAPPAT*
Ga0116153_1006737833300009838Anaerobic Digestor SludgeCTRGAVQDYDVVLYILALAKTVTPGGSPRREPGQAAPPTT*
Ga0116153_1016050913300009838Anaerobic Digestor SludgeTRGAMQGYDVVLYILALAKTVTPGGGPRREPGQAVPPTT*
Ga0116153_1026728513300009838Anaerobic Digestor SludgeQGYDVVLFILAMAKTVTPGGSPRRQPGRAVAQATKPLL*
Ga0116153_1035851713300009838Anaerobic Digestor SludgeTRGAVWGYDVVLFILALAKTVTPAGGPRREPGQAAPPTT*
Ga0130016_1015242543300009868WastewaterCFCTRGAKQGYDIDLFILALAKTVTPGGSPRREPGQAVPPTT*
Ga0116239_1004566213300010346Anaerobic Digestor SludgeQDYDVVLFVLALAKTVTPEGGPRREPGRAVPPTT*
Ga0116239_1010357843300010346Anaerobic Digestor SludgeTRGAMQVYDVVLFVLALAKTVTPGGSPRREPGQAAPPTT*
Ga0116240_1010460433300010349Anaerobic Digestor SludgeDYDGYLFILALAKTVTPGGGPRREPGRPVPLATLLTF*
Ga0116240_1066936833300010349Anaerobic Digestor SludgeRDAMQGYDVVLFIVALAKTVTPRGSPRREPGQAAPPTT*
Ga0116244_1002618573300010350Anaerobic Digestor SludgeFCTLGAMQGYDVVLIIVALAKTVTPGGGPRREPGQAAPPTT*
Ga0116244_1031677413300010350Anaerobic Digestor SludgeFCTRGAMQDYDVVLFILALAKTVTPGGGPRREPGQAAPLTT*
Ga0116248_1046928223300010351Anaerobic Digestor SludgeGYDVVLFILALAKTVTPGGSPRREPGQAVAPATKPSLY*
Ga0116247_1013856413300010352Anaerobic Digestor SludgeTRGAMQSYDVDLFILALAKTVTPGGSPRREPGQAAPPTT*
Ga0116247_1018862513300010352Anaerobic Digestor SludgeCFCTRGAVQDYDVRLFILALAKTVTPRGSPRREPGQAAPPTT*
Ga0116247_1020049933300010352Anaerobic Digestor SludgeGAMQGYDVVLFILALAKTVTPGGSPRREPGQAAPPAT*
Ga0116247_1036360333300010352Anaerobic Digestor SludgeRGAMQDYDVVLFILALAKTVTPGGGPRREPGQVAPPTT*
Ga0116247_1038564013300010352Anaerobic Digestor SludgeCTRGAQQSYDVVLFILALAKTVTPGGGPRREPGQAAPPTT*
Ga0116247_1056335913300010352Anaerobic Digestor SludgeMQGYDVDLFVLALAKTVTPSGGPRREPGQAAPPTN*
Ga0116247_1057179413300010352Anaerobic Digestor SludgeFCTRGAMQVCDVVLFIVALAKTVTPGGSPRREPGQAAPPTT*
Ga0116247_1090821023300010352Anaerobic Digestor SludgeTRGAMQGYDVVLFIVALAKTVTPRGGPRRQPGRPAPPL*
Ga0116247_1136498323300010352Anaerobic Digestor SludgeMQVYDVVLNIVALEKTVTPGGGPRREPGQAAPLTT*
Ga0116236_1012396453300010353Anaerobic Digestor SludgeCNRGAVQGYDVVLFIVALAKTVTPGGGPRREPGRAVPPTT*
Ga0116236_1016432013300010353Anaerobic Digestor SludgeMQGHDVVLFILALAKTVTPGGGPRREPGQAAPPTT*
Ga0116236_1030353433300010353Anaerobic Digestor SludgeFCTRGAMQGYDGYYFILALAKTVTPGGSPRREPGQAAPPTT*
Ga0116236_1080396113300010353Anaerobic Digestor SludgeTRGAMQGYDVVLFILALAKTVTPGGGPRREPGQAAPPTT*
Ga0116242_1049879013300010355Anaerobic Digestor SludgeRGAMQDYDVYLFVLALAKTVTPEGGPRREPGQPVPPTTEQSN*
Ga0116237_1038479333300010356Anaerobic Digestor SludgeRGAMQDYDVDLFIVALAKTVTPRGSPRREPGQAAPLTT*
Ga0116237_1054634813300010356Anaerobic Digestor SludgeVQDYDVVLSVLALAKTVTPGEGPRREPGLAAPPTT*
Ga0116237_1150034123300010356Anaerobic Digestor SludgeMHGYDGYYFILALAKTVTPGGGPRREPGQAAPLTT*
Ga0116249_1008461263300010357Anaerobic Digestor SludgeTRGAIQGYDIVLSIVALAKTVTPGGSPRREPGQAVPPTT*
Ga0116249_1025449833300010357Anaerobic Digestor SludgeRGAVQGYDVVLFIVALAKTVTPGGSPRREPGQAAPPTT*
Ga0116249_1059739323300010357Anaerobic Digestor SludgeRGAMQGYDGYYLILALAKTVTPGGGPRRQPGQAAPLTT*
Ga0116249_1064581823300010357Anaerobic Digestor SludgeTRGAMQGYDGYYLILALAKTVTPGGGPRREPGQAAPLTT*
Ga0116249_1072666923300010357Anaerobic Digestor SludgeRGAMQGYDVVLFILALAKTVTPGGGPRREPGQAAPPTT*
Ga0116249_1088603013300010357Anaerobic Digestor SludgeCTRGAEQGYDVDLFVLALAKTVTPPGSPRRVPGQAAPSTT*
Ga0116249_1100946623300010357Anaerobic Digestor SludgeVALPQSRGGARFCTRGAMQGNDGYYLIVALAKTVTPGGGPRRE
Ga0116249_1128530413300010357Anaerobic Digestor SludgeRDAKQDYDVVLNIVALAKTVTPAGGPRREPGQAAPPAT*
Ga0116249_1138766223300010357Anaerobic Digestor SludgeAMQGYYVVLFIVAVAKTVTPIGGPRREPGQAAPPTT*
Ga0116249_1197670823300010357Anaerobic Digestor SludgeACFCTRGAMRVYDVDLFILALAKTVTPGGSPRREPGQAAPLTTNGPL*
Ga0116241_1014512413300010429Anaerobic Digestor SludgeRGAMRVYDVDLFILALAKTVTPGGGPRREPGRAAPPTT*
Ga0116241_1046512123300010429Anaerobic Digestor SludgeCTRGAMQGYDVVLLILALAKTVTPGGSPRREPGQAAPPTT*
Ga0116241_1048989813300010429Anaerobic Digestor SludgeTRGAVQGYDGYYFILALAKTVTPQGSPRREPGQAAPPTT*
Ga0116241_1052847613300010429Anaerobic Digestor SludgeTRGAMLGYDVVLFILALAKTVTPGGSAPRERGRAAPPTT*
Ga0116241_1065682713300010429Anaerobic Digestor SludgeHGAMHYYDVVLFIIALAKTVTPGGGPRREPGQAAPPTT*
Ga0116241_1070854133300010429Anaerobic Digestor SludgeCTRGAMQDYDVVLFILALAKTVTPGGDPRREPGQAAPPTT*
Ga0116241_1071326123300010429Anaerobic Digestor SludgeRFCTRGAMQVYDVALFIVALAKTVTPRGSPRREPGQAVPPTT*
Ga0116241_1084579623300010429Anaerobic Digestor SludgeAMQGYDIILFILALAKTVTPGGSPRREPGRPVPPTT*
Ga0116241_1088072313300010429Anaerobic Digestor SludgeQGYDVVLFILALAKTVTPIGSPRREPGQAAPPTT*
Ga0116241_1145460513300010429Anaerobic Digestor SludgeQGYDVDLIILALAKTVTPPGSAPRERGRAAPPTT*
(restricted) Ga0172365_1060129523300013127SedimentGGARFCTRGAMQGYDGYYFILALAKTVTPAGGPRREPGRAVAPATKPPL*
Ga0075320_108534013300014255Natural And Restored WetlandsACFCTRGAVQDYDGYLFILALAKTVTPGGSPRREPGQAAPPTT*
Ga0075315_107905223300014258Natural And Restored WetlandsCFCTRGAVQGYDGYYLVLALAKTVTPRGSPRRQPGQAVAPATKLPL*
Ga0179935_130328513300019231Anaerobic Digestor SludgeGARFCTRGAMKGYDGYYFVLALAKTVTPGGSPRREPGQAVAQATKPPI
Ga0214088_114185923300020814Granular SludgeFCTRGAMQDYDVDLFIVALAKTVTPGGGPLRKQGQAAPPTT
Ga0214088_144454413300020814Granular SludgeDAVLFILALAKTVTSGGSPRREPGQAAPPTTYLSS
Ga0226659_1025636823300021603Granular SludgeCTRGAMQGYDVVLFIVALAKTVTPGGSPRREPGRAAPPTT
Ga0226659_1026306433300021603Granular SludgeFCTRGAMQDYDVVLLILALAKTVTPPGGPRREPGQAAPPAT
Ga0226659_1035483413300021603Granular SludgeVPNEERSGCFCTRGAMQDCDVVLFIVALAKTVTPEGSPRREPGQAAPPTT
Ga0210112_109626223300025563Natural And Restored WetlandsMQGYDVVLFILALAKTVTPGGGPRREPGQAAPLSTYG
Ga0209408_101407263300025611Anaerobic Digestor SludgeMQGYDVVLFILALAKTVTPGGGPRREPGQAAPPTT
Ga0209408_102133813300025611Anaerobic Digestor SludgeMQDYDVVLFIIALAKTVTPGGSPRREPGQAVAPTTEPSSSFTQ
Ga0209408_108185313300025611Anaerobic Digestor SludgeMQGYDVVLFILALAKTVTPGGSAPRERGRAAPPTT
Ga0209408_110016113300025611Anaerobic Digestor SludgeYDVVLSIVALAKTVTPRGSPRREPGQAAPLTTNRSSLA
Ga0209203_111174543300025702Anaerobic Digestor SludgeMQGYDVVLFVLALAKTVTPAGGPRREPGRAVAPTTKPPL
Ga0209203_114886423300025702Anaerobic Digestor SludgeGAMQGYDVDLFVLALAKTVTPGGGPRREPGRAVAPATKPPL
Ga0209203_124281313300025702Anaerobic Digestor SludgeTRGAMRDYDVYLFILALAKTVTPPGSPRREPGQAAPPIP
Ga0209507_108561013300025706Anaerobic Digestor SludgeCTRGAMQDYDFVLSILALAKTVTPGGSPRREPGQAAPPTT
Ga0209201_102074813300025708Anaerobic Digestor SludgeMQGYDVDLFIFALAKTVTPRGGPRRKPGQAAPPTT
Ga0209310_113044813300025715Anaerobic Digestor SludgeAKQGYGVVLFILALAKTVTPGGRPRREPGQAVPLTT
Ga0209310_117375923300025715Anaerobic Digestor SludgeGAMQGYDGYYFILALAKTVKPGGSAPRERGRAAPLTT
Ga0209607_102980143300025847Anaerobic Digestor SludgeTRGAMQGYDVVLFILALAKTVTPGGSPRREPGQAAPPTT
Ga0209717_103668033300025855Anaerobic Digestor SludgeMQGYAVVLFVLALAKTVTPGGSAPRERGRAVPLAT
Ga0209604_113753533300025856Anaerobic Digestor SludgeFALVVMQGYDGYYLILALAKTVTPGGGPRREPGRAVPPTTFSDLL
Ga0209604_121617723300025856Anaerobic Digestor SludgeMQGYDVVLIILAMAKTVTPPGGPRREPGQAAPPNT
Ga0209604_123848123300025856Anaerobic Digestor SludgeACFCTRGAMQGYDGYYFILALAKTVTPGGSPRREPGQAAPPTT
Ga0209099_104825913300025858Anaerobic Digestor SludgeAMQEYDVDLFILALAKTVTPGGGPRREPGQAAPPTT
Ga0209099_114742413300025858Anaerobic Digestor SludgeRGAMQDYDIVLIIVTLAKTVTPGGSPRREPGQAVPPTT
Ga0209099_123686213300025858Anaerobic Digestor SludgeCTRGAMQGYDVDLFILALAKTVTPPGGPRREPGQAAPPTT
Ga0209096_119252723300025859Anaerobic Digestor SludgeMQDYDGVLNIVALAKTVTPRGSPRREPGLAAPPTT
Ga0209605_101037113300025861Anaerobic Digestor SludgeARFCTRGAIQGYDVVLYILALAKTVTPGGGPRREPGQAAPPTT
Ga0209098_109680033300025867Anaerobic Digestor SludgeALQDYDVVLFILALAKTVTPAGGPRREPGRAVPPAT
Ga0209098_115320823300025867Anaerobic Digestor SludgeGAMQGYDVVLFILALAKTVTPGGSARREPGRAAPPTT
Ga0209098_127511913300025867Anaerobic Digestor SludgeFCTRGAMPGYDVVLFVLALAKTVTPGGSPRREPGQAAPPTT
Ga0209311_113069113300025871Anaerobic Digestor SludgeRGAMQDYDVYLFVLALAKTVTPEGGPRREPGQPVPPTTEQSN
Ga0209311_123805013300025871Anaerobic Digestor SludgeYDVDLFILALAKTVTPAGGPRREPGRAVAPATKPPL
Ga0208460_1017570423300025877Anaerobic Digestor SludgeCFCTRGAVQSYNVVLFIVALAKTVTPRGSPRRQPGQAAPLTA
Ga0209202_102850913300025902Anaerobic Digestor SludgeACFCTRGAMQGHDGYYFILALAKTVTPGGSPRREPGRAVPLTT
Ga0209202_103117143300025902Anaerobic Digestor SludgeYDVVLNIVALAKTVTPPRGPRREPGQAVAPVTKPPL
Ga0209202_107000813300025902Anaerobic Digestor SludgeCTRGAMQGYDVDLFILALAKTVTPGGGPRREPGQAAPPTT
Ga0209202_110497213300025902Anaerobic Digestor SludgeTRGAMLGYDVVLFILALAKTVTPGGSAPRERGRAAPPTT
Ga0209202_112053123300025902Anaerobic Digestor SludgeLQGYDGYYFILALAKTVTPQGSPRREPGQAAPPTT
Ga0209202_114727733300025902Anaerobic Digestor SludgeFCARGAMQGYDGYYFIFALAKTVTPGGSAPRERGRAAPPTT
Ga0209202_118691723300025902Anaerobic Digestor SludgeVQDYDGYYLILALAKTVTPEGSPRREPGQAAPLTI
Ga0209510_106259623300026290Anaerobic Biogas ReactorAMQGYVGYYFVLALAKTVTPAGGPRREPGQAAPLTT
Ga0209510_109792313300026290Anaerobic Biogas ReactorGGARFCTRGAMQGYDGYYLILALAKTVTPGGSPRREPGQAAPPTT
Ga0209723_131937923300026311Anaerobic Biogas ReactorFCTRGAMRGYDVDLFILALAKTVTPGGSPRREPGQAAPLTTNGPL
Ga0209467_120505813300027719FreshwaterFCTRGAMQGYDVALFILALAKTVTPGGGPRREPGQAAPLTT
Ga0209467_125753913300027719FreshwaterMQSYDGYYFILALAKTVTPGGGPRRKPGQAAPQTT
Ga0209492_120817813300027721Freshwater SedimentMQGYNVDLFIVALAKTVTPRVGPRREPGQAAPLTTQQS
Ga0209575_1007505213300027739FreshwaterCTRGAVQGYDGYYFILALAKTVTPQGSPRREPGQAAPPTT
Ga0209575_1016805533300027739FreshwaterGAMQGYDVVLFILALAKTVTPGGGPRREPGRAVALATKPPL
Ga0209373_1028683813300027796FreshwaterSGCFCTRGAMQGYDGYYFILALAKTPDESGQAVTPGGGPWREPGQAAPPTT
Ga0209800_1007625343300027800FreshwaterTCGAMQDYDGYYLILALAKTVTPEGCPRREPGQAAPPTT
Ga0209800_1033381913300027800FreshwaterGAMQGYDVVLFILALAKTVTPRGGPRREPGQAVAPATKPPF
Ga0209079_1025943413300027972Freshwater SedimentACCCTRGAIQGYDVVLSIVALAKTVTPGGSPRREPGQAAPLTT
Ga0209391_1018245213300027975Freshwater SedimentGCFCTRGAMQGYDCYYFILALAKTVTPAGGPWREPGRAVAPATELPL
Ga0307352_10524333300028849Anaerobic Digestor SludgeAMQGYDVVLFILALAKTVTPPGGPRREPGQAAPLTT
Ga0307358_10147413300028850Anaerobic Digestor SludgeGYDVVLFILALAKTVTPPGDPRREPGRAAPPTTGLSS
Ga0307358_11053933300028850Anaerobic Digestor SludgeRDALQDYDCYLFILALAKTVTPGGSPRREPGQAAPLAT
Ga0243129_101472753300029797SedimentFCTRGAMQDYDVVLFILALAKTVTPGGGPRRESGQAAPLTT
Ga0243129_105613833300029797SedimentTRGAMQDYDVVLFILALAKTVTPGGGPRREPGQVAPPTT
Ga0243129_114361713300029797SedimentAMQVCDVVLYIVALAKTVTPGGGPRREPGQAAPPTT
Ga0311022_1050718713300029799Anaerobic Digester DigestateAMQGYDVVLFIVALAKTVTPGGSPRREPGQAAPPTT
Ga0307324_10214343300029834Anaerobic Digestor SludgePGCFCTRDALQDYGVVLSILALAKTVTPEGSPRQEPGQAAPPTT
Ga0168096_102506613300029942BiosolidsMQGYDVVLFIVALAKTVTPGGGPRREPGQAAPPTT
Ga0316613_1030188313300033434SoilGAMQGYDVVLFILALAKTVTPGGGPRREPGQAALPTT
Ga0316613_1122064423300033434SoilAMQGYDGYNFILALAKTVTPGGSPRREPWRAAPPTT
Ga0373404_0239183_266_3733300033757Anaerobic Digester LeachateMQGYDDDLFILALAKTVTPGGSPRREPGQAAPLTT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.