NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F030486

Metagenome / Metatranscriptome Family F030486

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F030486
Family Type Metagenome / Metatranscriptome
Number of Sequences 185
Average Sequence Length 41 residues
Representative Sequence NVRRYVALAQSRGGARFCTRGAMQDYAVITLFSRWQKP
Number of Associated Samples 102
Number of Associated Scaffolds 185

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.73 %
% of genes near scaffold ends (potentially truncated) 81.08 %
% of genes from short scaffolds (< 2000 bps) 84.32 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.432 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge
(47.027 % of family members)
Environment Ontology (ENVO) Unclassified
(71.892 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(63.784 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 185 Family Scaffolds
PF08378NERD 5.41
PF05016ParE_toxin 4.32
PF03544TonB_C 2.70
PF01381HTH_3 2.70
PF00578AhpC-TSA 1.62
PF12099DUF3575 1.62
PF02452PemK_toxin 1.62
PF14137DUF4304 1.08
PF03190Thioredox_DsbH 1.08
PF13715CarbopepD_reg_2 1.08
PF06769YoeB_toxin 1.08
PF13905Thioredoxin_8 1.08
PF13181TPR_8 1.08
PF13271DUF4062 1.08
PF14289DUF4369 1.08
PF01909NTP_transf_2 1.08
PF07661MORN_2 1.08
PF00929RNase_T 0.54
PF14054DUF4249 0.54
PF08861DUF1828 0.54
PF01979Amidohydro_1 0.54
PF04055Radical_SAM 0.54
PF12158DUF3592 0.54
PF14062DUF4253 0.54
PF07007LprI 0.54
PF02566OsmC 0.54
PF05168HEPN 0.54
PF01694Rhomboid 0.54
PF13588HSDR_N_2 0.54
PF00656Peptidase_C14 0.54
PF04140ICMT 0.54
PF01789PsbP 0.54
PF02493MORN 0.54
PF13337BrxL_ATPase 0.54
PF12675DUF3795 0.54
PF08534Redoxin 0.54
PF07676PD40 0.54
PF06940DUF1287 0.54
PF01934HepT-like 0.54
PF12950TaqI_C 0.54
PF07927HicA_toxin 0.54
PF11731Cdd1 0.54
PF13495Phage_int_SAM_4 0.54
PF16301DUF4943 0.54

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 185 Family Scaffolds
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 2.70
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 1.62
COG2849Antitoxin component YwqK of the YwqJK toxin-antitoxin moduleDefense mechanisms [V] 1.62
COG1331Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domainsGeneral function prediction only [R] 1.08
COG4115Toxin component of the Txe-Axe toxin-antitoxin module, Txe/YoeB familyDefense mechanisms [V] 1.08
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 0.54
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.54
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.54
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.54
COG1895HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.54
COG2250HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.54
COG2361HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.54
COG2445Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 familyGeneral function prediction only [R] 0.54
COG3738Uncharacterized conserved protein YijF, DUF1287 familyFunction unknown [S] 0.54
COG3755Uncharacterized conserved protein YecT, DUF1311 familyFunction unknown [S] 0.54
COG4249Uncharacterized conserved protein, contains caspase domainGeneral function prediction only [R] 0.54
COG4642Uncharacterized conserved proteinFunction unknown [S] 0.54


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.43 %
UnclassifiedrootN/A27.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000507|Draft_104906All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1776Open in IMG/M
3300000558|Draft_10159093Not Available561Open in IMG/M
3300000568|Draft_10759999Not Available608Open in IMG/M
3300001567|Draft_10026652All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2609Open in IMG/M
3300001580|Draft_10109654All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Salegentibacter → Salegentibacter salarius1428Open in IMG/M
3300001580|Draft_10159050Not Available1081Open in IMG/M
3300001580|Draft_10161989Not Available1066Open in IMG/M
3300002079|CSTR_1019064All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales6454Open in IMG/M
3300002164|JGI24708J26588_10062345All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Dysgonomonadaceae → Dysgonomonas → Dysgonomonas mossii1289Open in IMG/M
3300002168|JGI24712J26585_10053193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae1696Open in IMG/M
3300002220|MLSBCLC_10027220All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2249Open in IMG/M
3300002498|TOLCLC_10003133All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Salegentibacter → Salegentibacter salarius1379Open in IMG/M
3300004241|Ga0066604_10147493All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Carboxylicivirga → Carboxylicivirga marina936Open in IMG/M
3300004242|Ga0066601_10189749All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium779Open in IMG/M
3300004282|Ga0066599_100163554Not Available1163Open in IMG/M
3300005831|Ga0074471_10984860Not Available790Open in IMG/M
3300006224|Ga0079037_100107664All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium HGW-Bacteroidetes-172358Open in IMG/M
3300006381|Ga0079102_1031094Not Available904Open in IMG/M
3300006636|Ga0075525_10044883Not Available861Open in IMG/M
3300006653|Ga0101727_115615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium769Open in IMG/M
3300006668|Ga0101756_107186All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300006835|Ga0101935_1039711Not Available622Open in IMG/M
3300006882|Ga0102489_104215Not Available1506Open in IMG/M
3300006888|Ga0102492_106272All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1809Open in IMG/M
3300006888|Ga0102492_142024All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes517Open in IMG/M
3300006930|Ga0079303_10168304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium865Open in IMG/M
3300006950|Ga0075524_10131759All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1079Open in IMG/M
3300006950|Ga0075524_10253672All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum769Open in IMG/M
3300007896|Ga0111484_1007777All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium2403Open in IMG/M
3300009082|Ga0105099_10912884Not Available555Open in IMG/M
3300009095|Ga0079224_104601315All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria539Open in IMG/M
3300009131|Ga0115027_10938380Not Available672Open in IMG/M
3300009302|Ga0116012_1042163Not Available596Open in IMG/M
3300009406|Ga0116587_1040003Not Available767Open in IMG/M
3300009588|Ga0116232_1181864All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300009588|Ga0116232_1203743All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Alkaliflexus → Alkaliflexus imshenetskii727Open in IMG/M
3300009589|Ga0116233_1197038All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes542Open in IMG/M
3300009671|Ga0123334_1250675All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Rufibacter → Rufibacter tibetensis787Open in IMG/M
3300009674|Ga0116173_1153460All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300009680|Ga0123335_1020599All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium5435Open in IMG/M
3300009680|Ga0123335_1475717Not Available563Open in IMG/M
3300009685|Ga0116142_10242335All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae906Open in IMG/M
3300009687|Ga0116144_10307040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium813Open in IMG/M
3300009687|Ga0116144_10548021Not Available566Open in IMG/M
3300009688|Ga0116176_10084310All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia1714Open in IMG/M
3300009688|Ga0116176_10560706Not Available553Open in IMG/M
3300009692|Ga0116171_10110663All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1641Open in IMG/M
3300009692|Ga0116171_10226377All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1046Open in IMG/M
3300009692|Ga0116171_10395527All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes736Open in IMG/M
3300009692|Ga0116171_10424448All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300009692|Ga0116171_10473607All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes658Open in IMG/M
3300009692|Ga0116171_10593040All Organisms → cellular organisms → Bacteria → Caldiserica/Cryosericota group → Caldiserica → Caldisericia → Caldisericales → unclassified Caldisericales → Caldisericales bacterium572Open in IMG/M
3300009692|Ga0116171_10729387Not Available503Open in IMG/M
3300009693|Ga0116141_10436073All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300009694|Ga0116170_10250165Not Available1022Open in IMG/M
3300009694|Ga0116170_10692743Not Available531Open in IMG/M
3300009713|Ga0116163_1057848All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium GWA2_40_151584Open in IMG/M
3300009713|Ga0116163_1077365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium1315Open in IMG/M
3300009713|Ga0116163_1082661All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Muricauda1260Open in IMG/M
3300009713|Ga0116163_1105581Not Available1073Open in IMG/M
3300009713|Ga0116163_1106574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium1066Open in IMG/M
3300009713|Ga0116163_1232756Not Available635Open in IMG/M
3300009771|Ga0116155_10118809Not Available1161Open in IMG/M
3300009771|Ga0116155_10132743All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Robertkochia → Robertkochia solimangrovi1083Open in IMG/M
3300009771|Ga0116155_10149583All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1007Open in IMG/M
3300009771|Ga0116155_10180604All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300009771|Ga0116155_10185023Not Available882Open in IMG/M
3300009771|Ga0116155_10210354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae813Open in IMG/M
3300009771|Ga0116155_10220128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium791Open in IMG/M
3300009771|Ga0116155_10315672Not Available635Open in IMG/M
3300009775|Ga0116164_10047198All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales2218Open in IMG/M
3300009775|Ga0116164_10161483Not Available1020Open in IMG/M
3300009776|Ga0116154_10021665All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Labilibacter → Labilibacter marinus3285Open in IMG/M
3300009776|Ga0116154_10157813All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300009776|Ga0116154_10214790Not Available838Open in IMG/M
3300009776|Ga0116154_10263698All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300009776|Ga0116154_10484107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae526Open in IMG/M
3300009778|Ga0116151_10389132Not Available636Open in IMG/M
3300009781|Ga0116178_10450821All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300009838|Ga0116153_10148744Not Available972Open in IMG/M
3300009838|Ga0116153_10234156All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → Fibrobacteria → Fibrobacterales → Fibrobacteraceae → Fibrobacter → unclassified Fibrobacter → Fibrobacter sp.754Open in IMG/M
3300009868|Ga0130016_10144673All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1923Open in IMG/M
3300009868|Ga0130016_10393487All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Marinilabilia → Marinilabilia salmonicolor923Open in IMG/M
3300010310|Ga0116235_1055577All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300010346|Ga0116239_10375167Not Available972Open in IMG/M
3300010349|Ga0116240_10124633All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1972Open in IMG/M
3300010349|Ga0116240_10354033All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Dysgonomonadaceae → Dysgonomonas → unclassified Dysgonomonas → Dysgonomonas sp. 37-18999Open in IMG/M
3300010350|Ga0116244_10099781All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales2202Open in IMG/M
3300010351|Ga0116248_10295616All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1260Open in IMG/M
3300010352|Ga0116247_10110324All Organisms → cellular organisms → Bacteria2396Open in IMG/M
3300010352|Ga0116247_10340730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium1188Open in IMG/M
3300010353|Ga0116236_10157071All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2111Open in IMG/M
3300010353|Ga0116236_10220390All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1705Open in IMG/M
3300010353|Ga0116236_10517201All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes995Open in IMG/M
3300010357|Ga0116249_10760832Not Available883Open in IMG/M
3300010429|Ga0116241_10120070All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2251Open in IMG/M
3300010429|Ga0116241_10157077All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1911Open in IMG/M
3300010429|Ga0116241_10219299Not Available1560Open in IMG/M
3300010429|Ga0116241_10250537All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1438Open in IMG/M
3300010429|Ga0116241_10437023All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300010429|Ga0116241_10665162All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes805Open in IMG/M
(restricted) 3300013127|Ga0172365_10254271Not Available1058Open in IMG/M
(restricted) 3300013129|Ga0172364_10626239All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes672Open in IMG/M
3300014263|Ga0075324_1140127All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300014309|Ga0075317_1074617Not Available711Open in IMG/M
3300019210|Ga0179938_1191597All Organisms → cellular organisms → Bacteria → FCB group590Open in IMG/M
3300019247|Ga0179937_1025941All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes624Open in IMG/M
3300020814|Ga0214088_1156083Not Available786Open in IMG/M
3300020814|Ga0214088_1207391All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1627Open in IMG/M
3300020814|Ga0214088_1265703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes966Open in IMG/M
3300020814|Ga0214088_1549121Not Available1251Open in IMG/M
3300020814|Ga0214088_1685554All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Sunxiuqinia7633Open in IMG/M
3300021603|Ga0226659_10163042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium1074Open in IMG/M
3300023203|Ga0255812_10461840All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300023207|Ga0255811_10577331All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300023207|Ga0255811_10928539Not Available789Open in IMG/M
3300025611|Ga0209408_1025287All Organisms → cellular organisms → Bacteria1942Open in IMG/M
3300025611|Ga0209408_1055717Not Available1137Open in IMG/M
3300025692|Ga0209744_1055244All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1463Open in IMG/M
3300025702|Ga0209203_1067467All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Muricauda1268Open in IMG/M
3300025702|Ga0209203_1080147All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1126Open in IMG/M
3300025702|Ga0209203_1150155Not Available731Open in IMG/M
3300025706|Ga0209507_1029499All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1878Open in IMG/M
3300025706|Ga0209507_1060336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium1132Open in IMG/M
3300025706|Ga0209507_1119718All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes724Open in IMG/M
3300025715|Ga0209310_1012609All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae3788Open in IMG/M
3300025715|Ga0209310_1107543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium849Open in IMG/M
3300025715|Ga0209310_1124944All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes770Open in IMG/M
3300025739|Ga0209745_1031170Not Available2139Open in IMG/M
3300025739|Ga0209745_1060161All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1377Open in IMG/M
3300025748|Ga0208459_1006656All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae7916Open in IMG/M
3300025847|Ga0209607_1032267All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2836Open in IMG/M
3300025858|Ga0209099_1039667Not Available2409Open in IMG/M
3300025858|Ga0209099_1065626All Organisms → cellular organisms → Bacteria1705Open in IMG/M
3300025861|Ga0209605_1144924All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flammeovirga → Flammeovirga aprica → Flammeovirga aprica JL-4923Open in IMG/M
3300025877|Ga0208460_10176424All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium838Open in IMG/M
3300025902|Ga0209202_1052639All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium GWA2_40_151486Open in IMG/M
3300025902|Ga0209202_1060761All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1342Open in IMG/M
3300025902|Ga0209202_1095204All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Alkaliflexus → Alkaliflexus imshenetskii968Open in IMG/M
3300025902|Ga0209202_1114637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium847Open in IMG/M
3300025902|Ga0209202_1123091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium804Open in IMG/M
3300026066|Ga0208290_1000455All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2865Open in IMG/M
3300026311|Ga0209723_1084945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium1375Open in IMG/M
3300027690|Ga0209164_1046639All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2067Open in IMG/M
3300027719|Ga0209467_1020228All Organisms → cellular organisms → Bacteria3041Open in IMG/M
3300027719|Ga0209467_1076054All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1297Open in IMG/M
3300027719|Ga0209467_1094195All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1131Open in IMG/M
3300027719|Ga0209467_1106953Not Available1043Open in IMG/M
3300027719|Ga0209467_1147964All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium847Open in IMG/M
3300027719|Ga0209467_1219148Not Available657Open in IMG/M
3300027739|Ga0209575_10179202All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter soli756Open in IMG/M
3300027739|Ga0209575_10203517All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes701Open in IMG/M
3300027739|Ga0209575_10242237All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium GWF2_41_31631Open in IMG/M
3300027739|Ga0209575_10297510Not Available557Open in IMG/M
3300027796|Ga0209373_10187677All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium GWF2_41_31885Open in IMG/M
3300027796|Ga0209373_10194852All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Paludibacteraceae → Paludibacter → Paludibacter jiangxiensis864Open in IMG/M
3300027796|Ga0209373_10213494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium814Open in IMG/M
3300027800|Ga0209800_10007460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium7005Open in IMG/M
3300027800|Ga0209800_10111687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium1233Open in IMG/M
3300027800|Ga0209800_10262471All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium735Open in IMG/M
3300027800|Ga0209800_10336768All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cesiribacteraceae → Cesiribacter → unclassified Cesiribacter → Cesiribacter sp. SM1629Open in IMG/M
3300027841|Ga0209262_10043365All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales2001Open in IMG/M
3300027841|Ga0209262_10144094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1140Open in IMG/M
3300027841|Ga0209262_10338778Not Available732Open in IMG/M
3300027885|Ga0209450_10678475All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes749Open in IMG/M
(restricted) 3300028593|Ga0255347_1121645Not Available1378Open in IMG/M
(restricted) 3300028593|Ga0255347_1132929All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia1286Open in IMG/M
3300028634|Ga0302242_1127778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium509Open in IMG/M
3300028846|Ga0307326_105413All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales1089Open in IMG/M
3300029311|Ga0167331_1047102All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300029799|Ga0311022_10139705All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes15581Open in IMG/M
3300029799|Ga0311022_12634600All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1437Open in IMG/M
3300029825|Ga0134835_1010139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium5150Open in IMG/M
3300029825|Ga0134835_1083695All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300029838|Ga0307348_104014All Organisms → cellular organisms → Bacteria1581Open in IMG/M
3300033419|Ga0316601_101184629All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes766Open in IMG/M
3300033434|Ga0316613_10679577All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes705Open in IMG/M
3300033481|Ga0316600_11163433All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes547Open in IMG/M
3300033483|Ga0316629_10296251Not Available1090Open in IMG/M
3300033521|Ga0316616_100737456All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1187Open in IMG/M
3300034158|Ga0370507_0147830All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium748Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge47.03%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater12.97%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments5.41%
Anaerobic Biogas ReactorEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor4.32%
SedimentEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment3.78%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.24%
Granular SludgeEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge3.24%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.70%
Anaerobic Digester DigestateEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate2.70%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.62%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.08%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment1.08%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater1.08%
Fermentation Pit MudEngineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud1.08%
WastewaterEngineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater1.08%
Biogas FermentantionEngineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion1.08%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.54%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.54%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.54%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.54%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.54%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil0.54%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.54%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.54%
Activated SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge0.54%
BiosolidsEngineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids0.54%
Wastewater Treatment PlantEngineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater Treatment Plant0.54%
Enrichment CultureEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture0.54%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000507Coal-degrading lab enrichment microbial communities from Bowden, Alberta, Canada- QSAFCN5EngineeredOpen in IMG/M
3300000558Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011EngineeredOpen in IMG/M
3300000568Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC:EngineeredOpen in IMG/M
3300001567Hydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, CanadaEngineeredOpen in IMG/M
3300001580Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6EngineeredOpen in IMG/M
3300002079CSTRmetagenomicsEngineeredOpen in IMG/M
3300002164Biogas fermentation microbial communities from Germany - Plant 1 DNA2EngineeredOpen in IMG/M
3300002168Biogas fermentation microbial communities from Germany - Plant 3 DNA2EngineeredOpen in IMG/M
3300002220Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011EngineeredOpen in IMG/M
3300002498Hydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, CanadaEngineeredOpen in IMG/M
3300004241Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11EnvironmentalOpen in IMG/M
3300004242Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006381Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Total_1113_SludgeMetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300006636Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-twoEnvironmentalOpen in IMG/M
3300006653Combined Assembly of Gp0123708, Gp0123962, Gp0123963EnvironmentalOpen in IMG/M
3300006668T14 (1) BES Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 timesEnvironmentalOpen in IMG/M
3300006835Combined Assembly of Gp0125097, Gp0125101, Gp0125102EnvironmentalOpen in IMG/M
3300006882T10 (2) BES, Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 timesEnvironmentalOpen in IMG/M
3300006888Combined Assembly of Gp0125122, Gp0125123, Gp0125658EnvironmentalOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300007896Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_3EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009095Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009302Combined Assembly of De NOVO T8 (live) Tyne Sediment Benzoate Gp0125097, Gp0125101, Gp0125102EnvironmentalOpen in IMG/M
3300009406Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_1 SPAdesEnvironmentalOpen in IMG/M
3300009588Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A SIP RNA (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300009589Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B SIP RNA (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300009671Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNAEngineeredOpen in IMG/M
3300009674Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaGEngineeredOpen in IMG/M
3300009680Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNAEngineeredOpen in IMG/M
3300009685Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaGEngineeredOpen in IMG/M
3300009687Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaGEngineeredOpen in IMG/M
3300009688Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaGEngineeredOpen in IMG/M
3300009692Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaGEngineeredOpen in IMG/M
3300009693Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaGEngineeredOpen in IMG/M
3300009694Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaGEngineeredOpen in IMG/M
3300009713Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaGEngineeredOpen in IMG/M
3300009771Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaGEngineeredOpen in IMG/M
3300009775Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaGEngineeredOpen in IMG/M
3300009776Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaGEngineeredOpen in IMG/M
3300009778Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaGEngineeredOpen in IMG/M
3300009781Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaGEngineeredOpen in IMG/M
3300009838Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaGEngineeredOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300010310Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B SIP RNA (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300010346AD_USMOcaEngineeredOpen in IMG/M
3300010349AD_HKTAcaEngineeredOpen in IMG/M
3300010350AD_HKSTcaEngineeredOpen in IMG/M
3300010351AD_USPNcaEngineeredOpen in IMG/M
3300010352AD_JPHWcaEngineeredOpen in IMG/M
3300010353AD_USCAcaEngineeredOpen in IMG/M
3300010357AD_USSTcaEngineeredOpen in IMG/M
3300010429AD_USRAcaEngineeredOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013129 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cmEnvironmentalOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014309Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D1EnvironmentalOpen in IMG/M
3300019210Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC030_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019247Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC028_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300020814Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahitEngineeredOpen in IMG/M
3300021603Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spadesEngineeredOpen in IMG/M
3300023203Combined Assembly of Gp0238866, Gp0238878EngineeredOpen in IMG/M
3300023207Combined Assembly of Gp0238866, Gp0238878, Gp0238879EngineeredOpen in IMG/M
3300025611Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025692Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes)EnvironmentalOpen in IMG/M
3300025702Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025706Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025715Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025739Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes)EnvironmentalOpen in IMG/M
3300025748Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025847Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025858Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025861Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025877Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025902Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG (SPAdes)EngineeredOpen in IMG/M
3300026066Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026311Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes)EngineeredOpen in IMG/M
3300027690Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG (SPAdes)EngineeredOpen in IMG/M
3300027719Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027739Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027796Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 (SPAdes)EnvironmentalOpen in IMG/M
3300027800Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 (SPAdes)EnvironmentalOpen in IMG/M
3300027841Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300028593 (restricted)Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24EngineeredOpen in IMG/M
3300028634Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_LysEngineeredOpen in IMG/M
3300028846Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Ala1 (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300029311Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP12 - Kappala-digested 113EngineeredOpen in IMG/M
3300029799Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119EngineeredOpen in IMG/M
3300029825Liquor fermentation pit mud microbial communities from Luzhou, China - Meta-1-2-440-MEngineeredOpen in IMG/M
3300029838Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Met1 (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034158Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Draft_10490643300000507Hydrocarbon Resource EnvironmentsMLAANVRRYVALPQSRGGACFCTRGAVQDYAVISYFSR
Draft_1013017713300000558Hydrocarbon Resource EnvironmentsMAHNVRRYVALAQSRGGACFFTRGAMQDYAVIIFFSRWQKP*HQEGVPG
Draft_1015909323300000558Hydrocarbon Resource EnvironmentsRYVQLAQSRGGACFCTRGAMQGYAVISLFSRWQKP*
Draft_1075999913300000568Hydrocarbon Resource EnvironmentsMAHNVRRYVALAQSRGGACFFTRGAMQDYAVIIFFSRWQKP*
Draft_1002665213300001567Hydrocarbon Resource EnvironmentsMWAGFYYMNANVRRYVALPQSRGGARFCTRGAVQGYDVICLLSRWQKP*
Draft_1010965433300001580Hydrocarbon Resource EnvironmentsNVRRYVQLAQSRGGACFCTRGAMQDHADITLFSRWQKP*
Draft_1015905013300001580Hydrocarbon Resource EnvironmentsLIGIILGIGSNVRRYVALAQSRGGARFCTCGAMQCYDVICLFSRWQKP*
Draft_1016198913300001580Hydrocarbon Resource EnvironmentsNVRRYVALAQSRGGACFCTRGAIQDYAVITLFSRWQKP*
CSTR_101906483300002079Wastewater Treatment PlantRYVALAQSRGGACFCTRGAVQDYAVITLFSRWQKP*
JGI24708J26588_1006234523300002164Biogas FermentantionMPVKLVCLVANVRRYVALAQSRGGACFCTRGAVQDYAVITLFSRWQKP*
JGI24712J26585_1005319323300002168Biogas FermentantionLAAVLFTLAGNVRRYVALAQSRGGACFCTRGAVQDYAVITLFSRWQKP*
MLSBCLC_1002722033300002220Hydrocarbon Resource EnvironmentsMCANVRRYVQLPQSRGGACFCTRGAMQDYAVITLFSRWQ
TOLCLC_1000313313300002498Hydrocarbon Resource EnvironmentsANVRRYVQLAQSRGGACFCTRGAMQDHADITLFSRWQKP*
Ga0066604_1014749313300004241FreshwaterMSHSVIIAHNVRRYVALPQCRGGACFCTRGAVQDYDVIGLFSRWQKP*
Ga0066601_1018974913300004242FreshwaterMLVPNVRRYVLLAQSRGGTRFCSRGAVQDYAVITLFSRWQKP
Ga0066599_10016355413300004282FreshwaterMVHNVRRYVQLAQSRGGAHFCIRGAMQDYDVVRLFSRWQKP*
Ga0074471_1098486013300005831Sediment (Intertidal)LPKTICANVRRYVQLAQLRGGTRFCTRDAMQGYAVITLFSRWQKP*
Ga0079037_10010766423300006224Freshwater WetlandsMIAGKVQINHNVWRYVQLAQLRGGECFCTRGAMQDYTVISLLSRWQKP*
Ga0079102_103109433300006381Anaerobic Digestor SludgeRYVALAQSRGGACFCTRGAMQDYDVICLFSRWQKP*
Ga0075525_1004488313300006636Arctic Peat SoilMGLLPQSRGGTRFCTRGAMQDYAVISLFSRWQKP*
Ga0101727_11561513300006653SedimentRYVALPQSRGGACFCTRGAVQDYAVNSLFSRWQKP*
Ga0101756_10718643300006668SedimentNVRRYVALAQSRGDARFYTRGAMCDYDVITLFSRWQKP*
Ga0101935_103971113300006835SedimentYVALAQSRGGACFCTRGVMQDYDVVCLFSRWQKP*
Ga0102489_10421553300006882SedimentVRRYVALAQSRGGACFCTRGAMQDYAVITLFSRWQKP*
Ga0102492_10627213300006888SedimentPNVRRYVALPQSRGGACFCTRGAVQDYAVNSLFSRWQKP*
Ga0102492_14202423300006888SedimentPITIMLAAIVTNVRRYVALAQSRGGARFCTRGEMQDYATITLFLRWQKP*
Ga0079303_1016830433300006930Deep SubsurfacePNVRRYVQLAQSRGGARFCTRGAVQDYAVITLFSRWQKP*
Ga0075524_1013175913300006950Arctic Peat SoilMGLLPQIRGGTRFCTRGAMQDYAVITLFSRWQKP*
Ga0075524_1025367213300006950Arctic Peat SoilMHVSTCLIMHPNVRRYVQLAQSRGGARFCTRDAMRDYAVITLFS
Ga0111484_100777733300007896SedimentVKLGLNITARRYVQLAQLRGGTRFCTRGAMKDYAVSSLLSRWQKP*
Ga0105099_1091288413300009082Freshwater SedimentRYVALAQSRGGACFCTRGAMQDYAVITLFSRWQKP*
Ga0079224_10460131523300009095Agricultural SoilRRYVALAQSRGGACFCTRGAVQDYEVISLFSRWQKP*
Ga0115027_1093838023300009131WetlandFWEVTYCCVVKMAGNVRRYVALAQSRGGARFCTRGAMQDYDVICLFSRWQKP*
Ga0116012_104216323300009302SedimentYVALAQSRGGACFCTRGAVQDYAVITLFSRWQKP*
Ga0116587_104000313300009406SedimentPCMQHNVRRYVALVRQLADGGACFCTRGAIQGYAVICLLSRWQKP*
Ga0116232_118186423300009588Anaerobic Biogas ReactorANVRRYVALAQSRGGACFCTRGAVQDYAVITLFSRWQKP*
Ga0116232_120374333300009588Anaerobic Biogas ReactorRYVALAQSRGGACFCTRGAMQGYAFITLFSRWQKP*
Ga0116233_119703813300009589Anaerobic Biogas ReactorYVALAQSRGGACFCTRGAIQGYDAICLFSRWQKP*
Ga0123334_125067513300009671Anaerobic Biogas ReactorMNSFSLVGNVRRYVALAQSRGGACFCTRGAVQDYAVITLFS
Ga0116173_115346033300009674Anaerobic Digestor SludgeMLPNVRRYVQLAQSRGGARFCTRGAMQGKAVITLFSRWQKP*
Ga0123335_102059963300009680Anaerobic Biogas ReactorNARRYVALAQSRGGACFCTRGAMQDYKVICLFSRWQKP*
Ga0123335_147571713300009680Anaerobic Biogas ReactorMLPNVRRYVQLAQSRGGTRFCTRGAMQGYAVITLFSR
Ga0116142_1024233523300009685Anaerobic Digestor SludgeNVRRYVALAQSRGGARFCTRGAMQDYDVIWLFSRWQKP*
Ga0116144_1030704023300009687Anaerobic Digestor SludgeRRYVQLAQSRGGACFCTRGAMQGYAVITLFSRWQKP*
Ga0116144_1054802113300009687Anaerobic Digestor SludgeRYVALAQSRGGACFCTRGAMRDYDVVCLFSRWQKP*
Ga0116176_1008431023300009688Anaerobic Digestor SludgeMCDVFFKMCGNVRRYVALAQLRGGACFCTRGAIQGYAVITLFSRWQKP*
Ga0116176_1056070613300009688Anaerobic Digestor SludgeQLPGMLPNVRRYVALAQSRGGTRFCSRGAVQDYPVNTLFSRWQKP*
Ga0116171_1011066333300009692Anaerobic Digestor SludgeRYVALAQSRGGACFCTRGAMQGYAVITLFSRWQKP*
Ga0116171_1022637713300009692Anaerobic Digestor SludgeLAANVRRYVALAQSRGGACFCTRGAMQVYAVSSLFSRWQKP*
Ga0116171_1039552733300009692Anaerobic Digestor SludgeRRYVALAQSRGGACFCTRGAMQDYAVITLLSRWQKP*
Ga0116171_1042444813300009692Anaerobic Digestor SludgeLSIGYNVRRYVALAQSRGGARFCTRGAMQDYAFITLFSRWQKP*
Ga0116171_1047360723300009692Anaerobic Digestor SludgeNVRRYVALAQSRGGARFCTRGAMQDYGVICLFSRWQKP*
Ga0116171_1059304013300009692Anaerobic Digestor SludgeMKIGHNVRRYVALAQSRGGARFCTRGAMQDYGVICLFSR
Ga0116171_1072938713300009692Anaerobic Digestor SludgeMHANVRRYVQLAQSRGGACFCTRGAMQGNAVITLFSRWQKP*
Ga0116141_1043607313300009693Anaerobic Digestor SludgeNVRRYVALAQSRGGARFCTRGAMQDYAFITLFSRWQKP*
Ga0116170_1025016543300009694Anaerobic Digestor SludgeYVALAQSRGGACFCTRGAMQDYDVICLFSRWQKP*
Ga0116170_1069274323300009694Anaerobic Digestor SludgeNVRRYVALAQSRGGARFCTRGAMQDYAVITLFSRWQKP*
Ga0116163_105784813300009713Anaerobic Digestor SludgeVRRYVQLAQSRGGACFCTRGAMQDYAVITLFSRWQKP*
Ga0116163_107736513300009713Anaerobic Digestor SludgeMLMLPNVRRYVALAQSRGGARFCTRGAMQDYPVITLFSRWQKP*
Ga0116163_108266113300009713Anaerobic Digestor SludgeRRYVQLAQSRGGACFCTRGAMQDYAVITLFSRWQKP*
Ga0116163_110558133300009713Anaerobic Digestor SludgeRRYVALAQSRGGACFCTRGAMQGYAVITLFSRWQKP*
Ga0116163_110657413300009713Anaerobic Digestor SludgeNVRRYVALAQSRGGACFCTRGAVQDYAVITLFSRWQKP*
Ga0116163_123275613300009713Anaerobic Digestor SludgeNVRRYVALAQSRGGACFCNRGAMQDYAVISLFSRWQKP*
Ga0116155_1011880923300009771Anaerobic Digestor SludgeRRYVALAQSRGGACFCTRGAMQDYAVITLFSRWQKP*
Ga0116155_1013274333300009771Anaerobic Digestor SludgeRYVQLAQSRGGACFCTRGAMQGYAVITLFSRWQKP*
Ga0116155_1014958333300009771Anaerobic Digestor SludgeMLTQLSLAGNVRRYVQLVRQLADGGARFCTRGAVQDYTVITLFSRWQKP*
Ga0116155_1018060413300009771Anaerobic Digestor SludgeRYVALAQSRGGACFCTRGAMQGYAVSILFSRWQKP*
Ga0116155_1018502323300009771Anaerobic Digestor SludgeVHNVRRYVQLAQSRGGACFCTRGAMQDLAGITLFSRWQKP*
Ga0116155_1021035413300009771Anaerobic Digestor SludgeRYVALPQSRGGARFCTRGAMQGYDVITLFSRWQKP*
Ga0116155_1022012823300009771Anaerobic Digestor SludgeTANVRRYVQLAQSRGGACFCTRGAMKDYAVITLFSRWQKP*
Ga0116155_1031567223300009771Anaerobic Digestor SludgeFLQIYNTKAYIMLTQLSLAGNVRRYVALAQSRGGARFCTRGAVQDYTVITLFSRWQKP*
Ga0116155_1041179523300009771Anaerobic Digestor SludgeVVVLLIITANVRRYVALAQSRGGARFCTRGAMQGY
Ga0116164_1004719833300009775Anaerobic Digestor SludgeAFSFQLIINCLHVMFANVRRYVALAQSRGGACFCTRGAVQDYAVNCLFSRWQKP*
Ga0116164_1016148323300009775Anaerobic Digestor SludgeSRFMLMLPNVRRYVALAQSRGGARFCTRGAMQDYAVITLFSRWQKP*
Ga0116154_1002166513300009776Anaerobic Digestor SludgeNVRRYVALPQSRGGACFCTRGEVQDYAVITSFSRWQKP*
Ga0116154_1015781313300009776Anaerobic Digestor SludgeLSLAGNVRRYVQLVRQLADGGARFCTRDAMQDYAIITLFSRWQKP*
Ga0116154_1016349243300009776Anaerobic Digestor SludgeYVALVRQLADGGACFCTRGAIQNYTVITLFSRWQKP*
Ga0116154_1021479013300009776Anaerobic Digestor SludgeVQCIVANVRRYVALAQSRGGARFCTRGAVQDYTVITLFSR
Ga0116154_1026369813300009776Anaerobic Digestor SludgeMQTIVANVRRYVALAQSRGGACFCTRGAVRDYTVNSLFSR
Ga0116154_1048410723300009776Anaerobic Digestor SludgeMHNVRRYVQLAQSRGGARFCTRGAMQDYAVISLFSRWQKP
Ga0116151_1038913223300009778Anaerobic Digestor SludgeLSRFMLMLPNVRRYVALAQSRGGARFCTRGAMQDYPVITLFSRWQKP*
Ga0116178_1045082123300009781Anaerobic Digestor SludgeYVALAQSRGGACFCTRGAMQDYDVIWLFSRWQKP*
Ga0116153_1014874413300009838Anaerobic Digestor SludgeYVALAQSRGGTCFCTRGAMQDFDVITLFSRWQKP*
Ga0116153_1023415613300009838Anaerobic Digestor SludgeANVRRYVALPQSRGGACFCTRGAMQDYAVICLFSRWQKP*
Ga0130016_1014467323300009868WastewaterMSKMVANVRRYVALAQSRGGACFCTRGAMQDLAVISLLSRWQKP*
Ga0130016_1039348713300009868WastewaterYVALAQSRGGACFCTRGAMQGYAVITLFSRWQKP*
Ga0116235_105557713300010310Anaerobic Biogas ReactorVRRYVALAQSRGGACFCTRGAVQDYAVITLFSRWQKP*
Ga0116239_1037516723300010346Anaerobic Digestor SludgeIVTNVRRYVQLAQSRGGACFCTSGAMQDYAGITLFSRWQKP*
Ga0116240_1012463343300010349Anaerobic Digestor SludgeYVALAQSRGGACFCTRGAMQEYDVICLFSRWQKP*
Ga0116240_1035403323300010349Anaerobic Digestor SludgeVLKVAANVRRYVQLAQSRGGTRFCTRGAMQGYAVITLFSRWQKP*
Ga0116244_1009978143300010350Anaerobic Digestor SludgeHVMFANVRRYVALAQSRGGACFCTRGAVQDYAVNCLFSRWQKP*
Ga0116248_1029561613300010351Anaerobic Digestor SludgeMVGNVRRYVALAQSRGGACFCTRGAVQDYAVISLF
Ga0116247_1011032433300010352Anaerobic Digestor SludgeKLILTANVRRYVALAQSRGGARFCTRGAMQDYAFITLFSRWQKP*
Ga0116247_1034073013300010352Anaerobic Digestor SludgeIAAIVTNVRRYVQLAQSRGGARFCTRGAMQDYDVNCLFSRWQKP*
Ga0116236_1015707123300010353Anaerobic Digestor SludgeVGLSEWFKMHLLSIGYNVRRYVALAQSRGGARFCTRGAMQDYAFITLFSRWQKP*
Ga0116236_1022039023300010353Anaerobic Digestor SludgeYFFLAAIVTNVRRYVALAQSRGGARFCTRGAMQDYAVITLFSRWQKP*
Ga0116236_1051720133300010353Anaerobic Digestor SludgeMRLMLANVRRYVQLAQSRGGACFCTRGAVWDYAVITLFSRW
Ga0116249_1076083233300010357Anaerobic Digestor SludgeNVRRYVALAQSRGGACFCTRGVMQDYAVITLFSRWQKP*
Ga0116241_1012007013300010429Anaerobic Digestor SludgeYFEFAANVRRYVQLAQSRGGARFCTRGAMQDYAVISLFSRWQKP*
Ga0116241_1015707753300010429Anaerobic Digestor SludgeMLTQLSLAGNVRRYVQLVRQLADGGARFCTRDAMQDYAVITLFSRWQKP*
Ga0116241_1021929913300010429Anaerobic Digestor SludgeYVALAQSRGGACFCTRGAMKGYAVISLFSRWQKP*
Ga0116241_1025053743300010429Anaerobic Digestor SludgeMLTQLSLAGNVRRYVALAQSRGGARFCTRGAVQDYTVITLFSRWQKP*
Ga0116241_1043702313300010429Anaerobic Digestor SludgeMQTIVANVRRYVALAQSRGGACFCTRGAVRDYTVNSLFSRW
Ga0116241_1066516213300010429Anaerobic Digestor SludgeRRYVQLAESRGGACFCTRDAMQDYAVITLFSRWQKP*
(restricted) Ga0172365_1025427113300013127SedimentFKSGFAMAHNVWRYVALAQSRGGACFCTRGAMQDYAVITLFSRWQKP*
(restricted) Ga0172364_1062623913300013129SedimentKLIRKSQNSMTTNVRRYVQLAQSRGGARFCTRDAMQDYAVITLFSRWQKP*
Ga0075324_114012713300014263Natural And Restored WetlandsYVALAQSRGGACFCTRGAMQVYAVITLFSRWQKP*
Ga0075317_107461713300014309Natural And Restored WetlandsGMGLLPQSRGGTCFCTRGAVQSYAVISLFSRWQKP*
Ga0179938_119159723300019210Anaerobic Digestor SludgeLQYMPHNVRRYVQLVRQLADGGACFCTRGAMQGYAVITLFSRWQKP
Ga0179937_102594123300019247Anaerobic Digestor SludgeLMHGNVPRYVQLAQSRGGARFCTRGAMQDYAVISLFSRWQKP
Ga0214088_115608323300020814Granular SludgeRYVALAQSRGGACFCTRGAMQGYAVITLFSRWQKP
Ga0214088_120739113300020814Granular SludgeNVRRYVALPQSRGGACFCTRGAMKDYAVITLFSRWQKP
Ga0214088_126570313300020814Granular SludgeRRYVALAQSRGGACFCTRGAMQGYAVITLFSRWQKP
Ga0214088_154912113300020814Granular SludgeNHNVRRYVALPQSRGGACFCTRGAVQGNAVINLFSRWQKP
Ga0214088_168555443300020814Granular SludgeMFANVRRYVALAQSRRGARFCTRGAVQDYDVNSLFSRWQKP
Ga0226659_1016304223300021603Granular SludgeIMLPNVRRYVQLAQSRGGTRFCTRGAMQGYAVITLFSRWQKP
Ga0255812_1046184013300023203Anaerobic Digester DigestateMRHNVRRYVALAQSRGGARFCTRGAMQDYAFITLF
Ga0255811_1057733123300023207Anaerobic Digester DigestateRYVQLAQSRGGTCFCTRGAVQDYAVNTLFSRWQKP
Ga0255811_1092853913300023207Anaerobic Digester DigestateVRRYVALPQSRGGAWFCTRGAMQGYAVFTLFSRWQKP
Ga0209408_102528743300025611Anaerobic Digestor SludgeNVRRYVALAQSRGGACFCTRGAVQDYAVITLFSRWQKP
Ga0209408_105571723300025611Anaerobic Digestor SludgeSNVRRYVALAQSRGGACFCTRGAMLDYAVITLFSRWQKP
Ga0209744_105524443300025692Arctic Peat SoilLTFRRYVQLALIRGGACFCTRGAMQDYAVISLFSRWQKP
Ga0209203_106746733300025702Anaerobic Digestor SludgeVRRYVQLAQSRGGACFCTRGAMQDYAVITLFSRWQKP
Ga0209203_108014713300025702Anaerobic Digestor SludgeLSFIRYSIATNVRRYVALAQSRGGACFCTRGAEQDYAVISLFSRWQKP
Ga0209203_115015513300025702Anaerobic Digestor SludgeNVRRYVALAQSRGGACFCTRGAMRDYTVITLFSRWQKP
Ga0209507_102949923300025706Anaerobic Digestor SludgeMCDVFFKMCGNVRRYVALAQLRGGACFCTRGAIQGYAVITLFSRWQKP
Ga0209507_106033613300025706Anaerobic Digestor SludgeSVFAHNVRRYVQLAQSRGGTRFCTRGAMQGYAVITLFSRWQKP
Ga0209507_111971813300025706Anaerobic Digestor SludgeMALNLKLTANVRRYVALTQSRGGARFCTRGAMQGYAVITLFSRWQKP
Ga0209310_101260913300025715Anaerobic Digestor SludgeNVRRYVALPQSRGGACFCTRGEVQDYAVITSFSRWQKP
Ga0209310_110754313300025715Anaerobic Digestor SludgeVVFDSLAANVRRYVQLAQSRGGTCFCTRGAMQDYAVIC
Ga0209310_112494423300025715Anaerobic Digestor SludgeRRYVQLAESRGGACFCTRDAMQDYAVITLFSRWQKP
Ga0209745_103117033300025739Arctic Peat SoilMANVRRYVLLAQLRGGARFCTRGAMKDYAVICLLSRWQKP
Ga0209745_106016113300025739Arctic Peat SoilRRYVQLAQSRGGACFCTRDAMQRYTVISLLSRWQKP
Ga0208459_100665683300025748Anaerobic Digestor SludgeMLPNVRRYVQLAQSRGGARFCTRGAMQGKAVITLFSRWQKP
Ga0209607_103226723300025847Anaerobic Digestor SludgeLSVYVIFIIAGNVRRYVALAQSRGGARFCTRDAMQDYAVITLFSRWQKP
Ga0209099_103966743300025858Anaerobic Digestor SludgeDVPFHIVRCDFMHANVRRYVQLAQSRGGACFCTRGAMQGNAVITLFSRWQKP
Ga0209099_106562633300025858Anaerobic Digestor SludgeLSIGYNVRRYVALAQSRGGARFCTRGAMQDYAFITLFSRWQKP
Ga0209605_114492433300025861Anaerobic Digestor SludgeMIISRRLIMLHNVRRYVALAQSRGGACFCTRGAMLDYAVIT
Ga0208460_1017642433300025877Anaerobic Digestor SludgeMCDVFFKMCGNVRRYVALAQLRGGACFCTRGAIQGYAVIT
Ga0209202_105263913300025902Anaerobic Digestor SludgeRRYVQLAQSRGGACFCTRGAMQDYAVITLFSRWQKP
Ga0209202_106076123300025902Anaerobic Digestor SludgeMLTQLSLAGNVRRYVQLVRQLADGGARFCTRDAMQDYAVITFFSRWQKP
Ga0209202_109520433300025902Anaerobic Digestor SludgeMLTQLSLAGNVRRYVALAQSRGGARFCTRGAVQDYTVITLFSRWQKP
Ga0209202_111463723300025902Anaerobic Digestor SludgeLQRSRYVALAQSRGGACFCTRDAMQDYAVITLFSRWQKP
Ga0209202_112309113300025902Anaerobic Digestor SludgeRYVALAQSRGGACFCTRGAMQDYDVICLFSRWQKP
Ga0208290_100045533300026066Natural And Restored WetlandsANVRRYVALAQSRGGARFCTRGAVQSYAVSSLFSRWQKP
Ga0209723_108494513300026311Anaerobic Biogas ReactorFIMLPNVRRYVQLAQSRGGTRFCTRGAMQGYAVITLFSRWQKP
Ga0209164_104663923300027690Enrichment CultureMSKMVANVRRYVALAQSRGGACFWTRGAVQDYPVDSLFSRWQKP
Ga0209467_102022843300027719FreshwaterMAYNVRRYVALAQIRGGACFCTRGAMQDYVVSILFSRWQKP
Ga0209467_107605413300027719FreshwaterNVRRYVALAQSRGGARFCTRGAMQGYAVITLFSRWQKP
Ga0209467_109419523300027719FreshwaterNVWRYVQLAQSRGGACFCTRGAMQDYAVITLLSRWQKP
Ga0209467_110695313300027719FreshwaterMYFSLQLTANVRRYVQLAQSRGGAGFCTRGAMQGYAVIALFSRWQKP
Ga0209467_114796413300027719FreshwaterATIGPNVWRYVALAQSRGGARFCTRGAIQGNAVITLFSRWQKP
Ga0209467_121914813300027719FreshwaterLLGLKHNVRRYVALPQSRGGACFCTRGAVQDYAVSSLFSRWQKP
Ga0209575_1017920213300027739FreshwaterVLSVTVAGNVRRYVALAQSRGGARFCTRGAMQGYAVITLFSRW
Ga0209575_1020351723300027739FreshwaterRYVQLAESRGGACFCTRDAMQDYAVITLFSRWQKP
Ga0209575_1024223733300027739FreshwaterMYFSLQLTANVRRYVALAQSLGGACFCTRGAMQDYAVITLFSR
Ga0209575_1029751013300027739FreshwaterYHLAAIVPNVWRYVALAQSRGGARFCTRGAIQGNAVITLFSRWQKP
Ga0209373_1018767713300027796FreshwaterFFRLRLAGNVRRYVALAQSRGGACFCTRGAVLGYPVSSLFSRWQKP
Ga0209373_1019485213300027796FreshwaterMXCSVIFANVRRYVQLAQSRGGTRFCTRGAMQGYAVITLF
Ga0209373_1021349413300027796FreshwaterVLSVTVAGNVRRYVALAQSRGGARFCTRGAMQGYAVITLFSR
Ga0209800_1000587313300027800FreshwaterMFTANVRRYVQLAQSRGGTRFCTRGAMQGYAVITL
Ga0209800_1000746013300027800FreshwaterMLANVRRYVALPQSRGGACFCTRGAQQGYAVSSLFSRWQKP
Ga0209800_1011168713300027800FreshwaterVRRYVALAQSRGGARFCTRGAMQGYAVITLFSRWQKP
Ga0209800_1026247113300027800FreshwaterLIIKAAIVPNVWRYVALAQSRGGARFCTRGAIQGNAVITLFSRWQKP
Ga0209800_1033676823300027800FreshwaterMVWVNMVYNVRRYVALPQSRGGACFCTRGAMQDYAVITLFSR
Ga0209262_1004336533300027841FreshwaterLRLAGNVRRYVALAQSRGGACFCTRGAVQDYAAFTLFSRWQ
Ga0209262_1014409413300027841FreshwaterQLTANVWRYVQLAQSRGGACFCTRGAMQDYAVITLLSRWQKP
Ga0209262_1033877823300027841FreshwaterMIRLRMRHNVRRYVQLVRQLADGGACFCTRGAMQGYD
Ga0209450_1067847523300027885Freshwater Lake SedimentMSNFINWSSNIAANVRRYVALAQSRGGARFCTRGAVQGYTVITLFSRWQKP
(restricted) Ga0255347_112164513300028593WastewaterGIGGITANVRRYVALAQSRGGACFCTRGAVQDYAVITLFSRWQKP
(restricted) Ga0255347_113292913300028593WastewaterMNANVRRYVALAQSRGGACFCTRGAVQDYAVITLFSRWQKP
Ga0302242_112777813300028634Activated SludgeNVRRYVALAQSRGGACLCTRGAMQGHAVITLFSRWQKP
Ga0307326_10541333300028846Anaerobic Digestor SludgeANNVLLAPLRGGACFCTRDAMQDYAVITLYSRWQKP
Ga0167331_104710213300029311BiosolidsVRRYVALAQSRGGACFCTRGAVQDYEVISLFSRWQKP
Ga0311022_1013970523300029799Anaerobic Digester DigestateMAGNVRRYVALAQSRGGACFCTRGVMQDYAVITLFSRWQKP
Ga0311022_1263460013300029799Anaerobic Digester DigestateRYVALAQSRGGACFCTRGAMQDYKVICLFSRWQKP
Ga0134835_101013913300029825Fermentation Pit MudRYVALPQSRGGACFCTRGAVQGNAVINLFSRWQKP
Ga0134835_108369513300029825Fermentation Pit MudVRRYVQLAQSRGGARFCTRGAMQGCDVVLLFSRWQKP
Ga0307348_10401413300029838Anaerobic Digestor SludgeRYVALAQSRGGACFCTRGAMQGYAVITLLSRWQKP
Ga0316601_10118462933300033419SoilRFSKPNNVRRYVALAQSRGGACFCTRGAVQNYAVNTLFSRWQKP
Ga0316613_1067957713300033434SoilMNQLQIFTNIVTNVRRYVQLVRQLADGGACFCTRGAVQGYDVICLLSRWQKP
Ga0316600_1116343313300033481SoilRRYVQLAQLRGGTCFCTRGLMQDYAVSSLLSRWQKP
Ga0316629_1029625113300033483SoilRYVALAQSRGGACFCTRGAVQNYAVNTLFSRWQKP
Ga0316616_10073745623300033521SoilMNQLQILTNIVANVRRYVQLVRQLADGGACFCTRSAMQDYAVISLFSRWQKP
Ga0370507_0147830_2_1243300034158Untreated Peat SoilILHFLILLCANVRRYVALPQSRGGACFCTRGAMQDYAFIS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.