Basic Information | |
---|---|
Family ID | F031988 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 181 |
Average Sequence Length | 39 residues |
Representative Sequence | VLLKIVYLLTRRVLGLAVLVFRGDRAKDAELLVLRHE |
Number of Associated Samples | 139 |
Number of Associated Scaffolds | 181 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 29.83 % |
% of genes near scaffold ends (potentially truncated) | 86.19 % |
% of genes from short scaffolds (< 2000 bps) | 82.87 % |
Associated GOLD sequencing projects | 130 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.193 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (11.050 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.177 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.724 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 181 Family Scaffolds |
---|---|---|
PF00196 | GerE | 2.76 |
PF13683 | rve_3 | 2.76 |
PF02604 | PhdYeFM_antitox | 1.66 |
PF11774 | Lsr2 | 1.66 |
PF01648 | ACPS | 1.66 |
PF05016 | ParE_toxin | 1.10 |
PF02371 | Transposase_20 | 1.10 |
PF13361 | UvrD_C | 1.10 |
PF04672 | Methyltransf_19 | 1.10 |
PF02254 | TrkA_N | 1.10 |
PF12833 | HTH_18 | 1.10 |
PF13443 | HTH_26 | 1.10 |
PF04011 | LemA | 0.55 |
PF00106 | adh_short | 0.55 |
PF07729 | FCD | 0.55 |
PF00582 | Usp | 0.55 |
PF13561 | adh_short_C2 | 0.55 |
PF13359 | DDE_Tnp_4 | 0.55 |
PF03551 | PadR | 0.55 |
PF00107 | ADH_zinc_N | 0.55 |
PF00903 | Glyoxalase | 0.55 |
PF00174 | Oxidored_molyb | 0.55 |
PF00805 | Pentapeptide | 0.55 |
PF13549 | ATP-grasp_5 | 0.55 |
PF04461 | DUF520 | 0.55 |
PF01609 | DDE_Tnp_1 | 0.55 |
PF01494 | FAD_binding_3 | 0.55 |
PF13466 | STAS_2 | 0.55 |
PF13280 | WYL | 0.55 |
PF08388 | GIIM | 0.55 |
PF12770 | CHAT | 0.55 |
PF05147 | LANC_like | 0.55 |
PF13377 | Peripla_BP_3 | 0.55 |
PF00589 | Phage_integrase | 0.55 |
PF13419 | HAD_2 | 0.55 |
PF11239 | DUF3040 | 0.55 |
PF01565 | FAD_binding_4 | 0.55 |
PF13005 | zf-IS66 | 0.55 |
PF07731 | Cu-oxidase_2 | 0.55 |
PF00313 | CSD | 0.55 |
PF01695 | IstB_IS21 | 0.55 |
PF00239 | Resolvase | 0.55 |
PF01381 | HTH_3 | 0.55 |
PF13384 | HTH_23 | 0.55 |
PF14269 | Arylsulfotran_2 | 0.55 |
PF07676 | PD40 | 0.55 |
PF13738 | Pyr_redox_3 | 0.55 |
PF09723 | Zn-ribbon_8 | 0.55 |
PF00082 | Peptidase_S8 | 0.55 |
PF01726 | LexA_DNA_bind | 0.55 |
PF13424 | TPR_12 | 0.55 |
PF13380 | CoA_binding_2 | 0.55 |
PF02738 | MoCoBD_1 | 0.55 |
PF08241 | Methyltransf_11 | 0.55 |
PF00781 | DAGK_cat | 0.55 |
PF07883 | Cupin_2 | 0.55 |
PF00202 | Aminotran_3 | 0.55 |
PF13676 | TIR_2 | 0.55 |
PF07690 | MFS_1 | 0.55 |
PF00441 | Acyl-CoA_dh_1 | 0.55 |
PF07311 | Dodecin | 0.55 |
PF09360 | zf-CDGSH | 0.55 |
PF13577 | SnoaL_4 | 0.55 |
PF01527 | HTH_Tnp_1 | 0.55 |
PF02653 | BPD_transp_2 | 0.55 |
COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
---|---|---|---|
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.66 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.66 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.10 |
COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.10 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.10 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.55 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.55 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.55 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.55 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.55 |
COG1666 | Cyclic di-GMP-binding protein YajQ, UPF0234 family | Signal transduction mechanisms [T] | 0.55 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.55 |
COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.55 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.55 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.55 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.55 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.55 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.55 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.55 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.55 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.55 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.55 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.55 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.55 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.55 |
COG4403 | Lantibiotic modifying enzyme | Defense mechanisms [V] | 0.55 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.55 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.19 % |
Unclassified | root | N/A | 34.81 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10223170 | Not Available | 721 | Open in IMG/M |
3300001449|JGI20208J14878_1001007 | All Organisms → cellular organisms → Bacteria | 5862 | Open in IMG/M |
3300001452|JGI20203J14952_1015092 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300003368|JGI26340J50214_10092661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 781 | Open in IMG/M |
3300003369|JGI24140J50213_10085307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1066 | Open in IMG/M |
3300004092|Ga0062389_100260370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia saprophytica | 1769 | Open in IMG/M |
3300005179|Ga0066684_10844686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Salinispora → Salinispora tropica | 602 | Open in IMG/M |
3300005529|Ga0070741_10068980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 4007 | Open in IMG/M |
3300005541|Ga0070733_10017664 | All Organisms → cellular organisms → Bacteria | 4454 | Open in IMG/M |
3300005545|Ga0070695_100949582 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300005602|Ga0070762_10009150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4920 | Open in IMG/M |
3300005921|Ga0070766_10155674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1403 | Open in IMG/M |
3300005994|Ga0066789_10360307 | Not Available | 608 | Open in IMG/M |
3300005995|Ga0066790_10484937 | Not Available | 529 | Open in IMG/M |
3300006028|Ga0070717_10730509 | Not Available | 900 | Open in IMG/M |
3300006028|Ga0070717_10927507 | Not Available | 793 | Open in IMG/M |
3300006028|Ga0070717_11633109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
3300006050|Ga0075028_100667134 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300006050|Ga0075028_100939150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
3300006059|Ga0075017_101103061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
3300006173|Ga0070716_100940413 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300006854|Ga0075425_102876008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
3300006953|Ga0074063_10090320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 590 | Open in IMG/M |
3300006954|Ga0079219_12281191 | Not Available | 523 | Open in IMG/M |
3300007255|Ga0099791_10256364 | Not Available | 830 | Open in IMG/M |
3300007265|Ga0099794_10228578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 957 | Open in IMG/M |
3300009089|Ga0099828_11198944 | Not Available | 673 | Open in IMG/M |
3300009098|Ga0105245_11458123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus | 735 | Open in IMG/M |
3300009098|Ga0105245_12960590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
3300009177|Ga0105248_11971082 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300009400|Ga0116854_1059058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1710 | Open in IMG/M |
3300009400|Ga0116854_1059835 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
3300009400|Ga0116854_1060567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis saalfeldensis | 791 | Open in IMG/M |
3300009523|Ga0116221_1037786 | All Organisms → cellular organisms → Bacteria | 2328 | Open in IMG/M |
3300009552|Ga0116138_1104783 | Not Available | 784 | Open in IMG/M |
3300009623|Ga0116133_1039011 | Not Available | 1175 | Open in IMG/M |
3300009628|Ga0116125_1101682 | Not Available | 769 | Open in IMG/M |
3300009644|Ga0116121_1133605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 782 | Open in IMG/M |
3300009683|Ga0116224_10033501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2522 | Open in IMG/M |
3300009762|Ga0116130_1014151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2771 | Open in IMG/M |
3300009824|Ga0116219_10751059 | Not Available | 533 | Open in IMG/M |
3300009839|Ga0116223_10274549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1012 | Open in IMG/M |
3300010048|Ga0126373_10364981 | Not Available | 1460 | Open in IMG/M |
3300010159|Ga0099796_10102720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1078 | Open in IMG/M |
3300010322|Ga0134084_10374215 | Not Available | 549 | Open in IMG/M |
3300010343|Ga0074044_10664463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
3300010358|Ga0126370_12257684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
3300010366|Ga0126379_10034300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4008 | Open in IMG/M |
3300010366|Ga0126379_10049876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3438 | Open in IMG/M |
3300010366|Ga0126379_10072502 | Not Available | 2944 | Open in IMG/M |
3300010371|Ga0134125_12475699 | Not Available | 564 | Open in IMG/M |
3300010373|Ga0134128_11645334 | Not Available | 707 | Open in IMG/M |
3300010375|Ga0105239_12561046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 595 | Open in IMG/M |
3300010379|Ga0136449_101007181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1340 | Open in IMG/M |
3300010379|Ga0136449_101542154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus | 1014 | Open in IMG/M |
3300010379|Ga0136449_101598892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 990 | Open in IMG/M |
3300010379|Ga0136449_104020814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
3300010876|Ga0126361_10333893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1131 | Open in IMG/M |
3300011269|Ga0137392_10342473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces europaeiscabiei | 1238 | Open in IMG/M |
3300011269|Ga0137392_10661456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 866 | Open in IMG/M |
3300012199|Ga0137383_10711355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 734 | Open in IMG/M |
3300012199|Ga0137383_10750150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 713 | Open in IMG/M |
3300012199|Ga0137383_11338394 | Not Available | 509 | Open in IMG/M |
3300012207|Ga0137381_10854893 | Not Available | 787 | Open in IMG/M |
3300012210|Ga0137378_10023134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5465 | Open in IMG/M |
3300012210|Ga0137378_10436162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1214 | Open in IMG/M |
3300012351|Ga0137386_11100735 | Not Available | 561 | Open in IMG/M |
3300012357|Ga0137384_10132600 | Not Available | 2086 | Open in IMG/M |
3300012357|Ga0137384_10176876 | Not Available | 1787 | Open in IMG/M |
3300012924|Ga0137413_10329805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1076 | Open in IMG/M |
3300013296|Ga0157374_11329543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
3300013306|Ga0163162_10290041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1768 | Open in IMG/M |
3300014158|Ga0181521_10305789 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 814 | Open in IMG/M |
3300014164|Ga0181532_10365568 | Not Available | 806 | Open in IMG/M |
3300014164|Ga0181532_10554997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. A2-31 | 626 | Open in IMG/M |
3300014200|Ga0181526_10210874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1241 | Open in IMG/M |
3300014493|Ga0182016_10818963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
3300014501|Ga0182024_11084509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
3300015374|Ga0132255_106312186 | Not Available | 502 | Open in IMG/M |
3300016730|Ga0181515_1077412 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300017821|Ga0187812_1075187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1118 | Open in IMG/M |
3300017821|Ga0187812_1117998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 862 | Open in IMG/M |
3300017821|Ga0187812_1220415 | Not Available | 605 | Open in IMG/M |
3300017822|Ga0187802_10318335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
3300017924|Ga0187820_1154003 | Not Available | 694 | Open in IMG/M |
3300017924|Ga0187820_1265236 | Not Available | 556 | Open in IMG/M |
3300017926|Ga0187807_1080706 | Not Available | 1016 | Open in IMG/M |
3300017926|Ga0187807_1085240 | Not Available | 989 | Open in IMG/M |
3300017928|Ga0187806_1255072 | Not Available | 608 | Open in IMG/M |
3300017933|Ga0187801_10180927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Alloactinosynnema → unclassified Alloactinosynnema → Alloactinosynnema sp. L-07 | 830 | Open in IMG/M |
3300017946|Ga0187879_10020620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4071 | Open in IMG/M |
3300017946|Ga0187879_10135426 | Not Available | 1399 | Open in IMG/M |
3300017972|Ga0187781_10466998 | Not Available | 904 | Open in IMG/M |
3300018030|Ga0187869_10316527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
3300018030|Ga0187869_10319785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. A2-31 | 745 | Open in IMG/M |
3300018033|Ga0187867_10256155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 985 | Open in IMG/M |
3300018037|Ga0187883_10355671 | Not Available | 749 | Open in IMG/M |
3300018037|Ga0187883_10774979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
3300018042|Ga0187871_10031232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3329 | Open in IMG/M |
3300018044|Ga0187890_10803426 | Not Available | 532 | Open in IMG/M |
3300019890|Ga0193728_1004136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7379 | Open in IMG/M |
3300019890|Ga0193728_1067517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1707 | Open in IMG/M |
3300020580|Ga0210403_11221977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
3300021403|Ga0210397_10340067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1110 | Open in IMG/M |
3300021478|Ga0210402_10170331 | Not Available | 1991 | Open in IMG/M |
3300021478|Ga0210402_12001537 | Not Available | 505 | Open in IMG/M |
3300025412|Ga0208194_1074866 | Not Available | 515 | Open in IMG/M |
3300025474|Ga0208479_1005762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea solani | 2635 | Open in IMG/M |
3300025474|Ga0208479_1059159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 745 | Open in IMG/M |
3300025494|Ga0207928_1055354 | Not Available | 750 | Open in IMG/M |
3300025504|Ga0208356_1062535 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300025504|Ga0208356_1063221 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300025588|Ga0208586_1001365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7608 | Open in IMG/M |
3300025588|Ga0208586_1120479 | Not Available | 558 | Open in IMG/M |
3300025604|Ga0207930_1094073 | Not Available | 690 | Open in IMG/M |
3300025625|Ga0208219_1000478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14356 | Open in IMG/M |
3300025625|Ga0208219_1003746 | All Organisms → cellular organisms → Bacteria | 5266 | Open in IMG/M |
3300025625|Ga0208219_1006113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4094 | Open in IMG/M |
3300025627|Ga0208220_1021980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2035 | Open in IMG/M |
3300025627|Ga0208220_1091692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 827 | Open in IMG/M |
3300025633|Ga0208480_1002571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrimicrobium → Ferrimicrobium acidiphilum | 6388 | Open in IMG/M |
3300025633|Ga0208480_1018763 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
3300025633|Ga0208480_1040894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1252 | Open in IMG/M |
3300025634|Ga0208589_1130122 | Not Available | 581 | Open in IMG/M |
3300025928|Ga0207700_10863747 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300026291|Ga0209890_10066628 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
3300026294|Ga0209839_10282303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
3300026295|Ga0209234_1195394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 692 | Open in IMG/M |
3300026310|Ga0209239_1265438 | Not Available | 591 | Open in IMG/M |
3300026360|Ga0257173_1009033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1109 | Open in IMG/M |
3300026498|Ga0257156_1002764 | All Organisms → cellular organisms → Bacteria | 3224 | Open in IMG/M |
3300026557|Ga0179587_10685760 | Not Available | 675 | Open in IMG/M |
3300026557|Ga0179587_10759639 | Not Available | 639 | Open in IMG/M |
3300026557|Ga0179587_10835765 | Not Available | 607 | Open in IMG/M |
3300026910|Ga0207840_1024898 | Not Available | 589 | Open in IMG/M |
3300027604|Ga0208324_1026125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1776 | Open in IMG/M |
3300027696|Ga0208696_1269751 | Not Available | 525 | Open in IMG/M |
3300027703|Ga0207862_1051661 | Not Available | 1239 | Open in IMG/M |
3300027812|Ga0209656_10069586 | Not Available | 1922 | Open in IMG/M |
3300027812|Ga0209656_10096263 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
3300027824|Ga0209040_10242893 | Not Available | 908 | Open in IMG/M |
3300027867|Ga0209167_10031290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2559 | Open in IMG/M |
3300028450|Ga0189898_1040166 | Not Available | 505 | Open in IMG/M |
3300028762|Ga0302202_10352737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
3300028784|Ga0307282_10170487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1035 | Open in IMG/M |
3300028813|Ga0302157_10067347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2399 | Open in IMG/M |
3300028882|Ga0302154_10310227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
3300029911|Ga0311361_10782028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 851 | Open in IMG/M |
3300029914|Ga0311359_10567363 | Not Available | 846 | Open in IMG/M |
3300029951|Ga0311371_11252714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 851 | Open in IMG/M |
3300029999|Ga0311339_10594802 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300030490|Ga0302184_10245549 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300030494|Ga0310037_10306699 | Not Available | 675 | Open in IMG/M |
3300030503|Ga0311370_10296170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2096 | Open in IMG/M |
3300030617|Ga0311356_10193498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2082 | Open in IMG/M |
3300030631|Ga0210279_10405458 | Not Available | 548 | Open in IMG/M |
3300030706|Ga0310039_10018195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3454 | Open in IMG/M |
3300030743|Ga0265461_12956764 | Not Available | 570 | Open in IMG/M |
3300031543|Ga0318516_10578523 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300031543|Ga0318516_10581329 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300031544|Ga0318534_10419543 | Not Available | 768 | Open in IMG/M |
3300031564|Ga0318573_10710288 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300031708|Ga0310686_106555740 | Not Available | 530 | Open in IMG/M |
3300031708|Ga0310686_119252054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura montaniterrae | 949 | Open in IMG/M |
3300031708|Ga0310686_119697778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6728 | Open in IMG/M |
3300031751|Ga0318494_10426853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
3300031890|Ga0306925_12093824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
3300031910|Ga0306923_11946022 | Not Available | 599 | Open in IMG/M |
3300031946|Ga0310910_11571892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
3300032035|Ga0310911_10896448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 511 | Open in IMG/M |
3300032160|Ga0311301_10307116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → environmental samples → uncultured Solirubrobacterales bacterium | 2532 | Open in IMG/M |
3300032160|Ga0311301_10761022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-02 | 1342 | Open in IMG/M |
3300032205|Ga0307472_100702422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 910 | Open in IMG/M |
3300032261|Ga0306920_100725583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya → Sporichthya polymorpha | 1463 | Open in IMG/M |
3300032261|Ga0306920_102325664 | Not Available | 742 | Open in IMG/M |
3300032515|Ga0348332_11934362 | Not Available | 612 | Open in IMG/M |
3300032770|Ga0335085_11759918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 636 | Open in IMG/M |
3300032805|Ga0335078_11935235 | Not Available | 634 | Open in IMG/M |
3300032892|Ga0335081_12676302 | Not Available | 510 | Open in IMG/M |
3300032896|Ga0335075_11669415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura litoris | 520 | Open in IMG/M |
3300033290|Ga0318519_11067782 | Not Available | 503 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 11.05% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.50% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.84% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.52% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.97% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.31% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.31% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.76% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.76% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.76% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.21% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.21% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.21% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.66% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.66% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.10% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.10% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.10% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.55% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.55% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.55% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.55% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.55% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.55% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.55% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.55% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001449 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow | Environmental | Open in IMG/M |
3300001452 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009400 | Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858 | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026910 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 65 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028450 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030631 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_102231701 | 3300001356 | Peatlands Soil | LGGRLLVKIVYLLVRRILHLVVLLFRRDMAKDAERRRGHLL |
JGI20208J14878_10010074 | 3300001449 | Arctic Peat Soil | VLLKIACLLMRWLFGLTVLVFHGDRAKNAELLVLRHENAVLR |
JGI20203J14952_10150921 | 3300001452 | Arctic Peat Soil | MVGWRVLKIVYLLTCRVLGVAVLVFRSDRGNAAELLV |
JGI26340J50214_100926613 | 3300003368 | Bog Forest Soil | VLLKIVYLLTCRVLGLAALGFRGDRVKDAELLVLRHENAV |
JGI24140J50213_100853071 | 3300003369 | Arctic Peat Soil | VLLKIVYLLIRRLLGLAVLVFRKDLAKDAELLVLRTPCC* |
Ga0062389_1002603702 | 3300004092 | Bog Forest Soil | LACRVLLKIVYLLMCRVLGLAVLAFRGDRAKDAELLVLRH |
Ga0066684_108446861 | 3300005179 | Soil | LACRVLLKIVYLLTCRAIGLAVLAFRGDRAKDAELLVLRHENA |
Ga0070741_100689806 | 3300005529 | Surface Soil | LAWCWLACRVLLKIVYVLTCLVVSLMVLVFPGDLAKDAELLVLRQENAVLR* |
Ga0070733_100176646 | 3300005541 | Surface Soil | MWCWLACRVLLKIVYVLRCRVLGLAVLVFGGDLAKDAEPTP |
Ga0070695_1009495823 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAVMVGGRVLLKIVYLLSCRVLGLAVLMIRGDRAKDAELL |
Ga0070762_100091501 | 3300005602 | Soil | VPLKIVYLLVRRVLGLAVLVFRTDLAKDAELLVLRH |
Ga0070766_101556743 | 3300005921 | Soil | MPLKVVCLLVPRILGLAVLISRGDLAKDAELLVLR |
Ga0066789_103603072 | 3300005994 | Soil | LACQVLLKIFYLLMRWSFSVTVLVFRGNEAKDAEILVLRH |
Ga0066790_104849371 | 3300005995 | Soil | LAVGVLLKIAYLLMRWTFGLAVLMFRGDQAKNAELLVL |
Ga0070717_107305092 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LAGRVLLKIVYLLVRQVLGLAILMFRGDGAREAELPVLRHENAVL |
Ga0070717_109275073 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LAGRVLLKVVCLLMRWTFGLAVLMLRGDQANNAEL |
Ga0070717_116331091 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LACRVPLKIVYLLTCRILGLAVLVFRGDRAKDAELLVLRHEN |
Ga0075028_1006671342 | 3300006050 | Watersheds | LAGRVLLKIVYLLTCRVLGLAVLVFRGDRAKDAELLVLRHE |
Ga0075028_1009391501 | 3300006050 | Watersheds | LACLVLLKIVYLLVCRILGLAVLTVRRDQSKEAELLVGCQKSA* |
Ga0075017_1011030611 | 3300006059 | Watersheds | LAGRVLLKIAYLLVRRIPGLAVLVFRGDRAKDAELL |
Ga0070716_1009404131 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VQLKIVYVIARRLLSLAVLVFRRDRTKDAELLVLR |
Ga0075425_1028760081 | 3300006854 | Populus Rhizosphere | VLLKIVYLLMCQVLGLVRLVFCGDLAKDAELLVLRHENAV |
Ga0074063_100903202 | 3300006953 | Soil | LAGRMLLKIVYLLMRSVLGLAVLVLRGDRAKDAELLVLRH* |
Ga0079219_122811911 | 3300006954 | Agricultural Soil | LACRMLLKIVYLLTCRVLGLAVVVFRGDLAKDAEL |
Ga0099791_102563641 | 3300007255 | Vadose Zone Soil | LADRVLLKIVYLLTCRVLDVAVLVFRGDRAKDAELLVL |
Ga0099794_102285782 | 3300007265 | Vadose Zone Soil | LAYEAVQRWLACQVLLKIACLLMRWLFSLAVVVVRGDRAKNAELLVLR |
Ga0099828_111989441 | 3300009089 | Vadose Zone Soil | LAGRVLLKIACLLMRWAFGLAVLMFRGDQAKNAELLVLR |
Ga0105245_114581232 | 3300009098 | Miscanthus Rhizosphere | LAGRVLLKIVYLLTCRVLGVAVLVFRGDRAKAAELLVLRHENELYRNCER* |
Ga0105245_129605901 | 3300009098 | Miscanthus Rhizosphere | MWCWLACRVLLKIVYLLTCRVLGLAVLVFRGDLAKDAELLV |
Ga0105248_119710822 | 3300009177 | Switchgrass Rhizosphere | LADQVLLKIVFLLMRWLFSLAVLVVRGDGEKNAELLVLRH |
Ga0116854_10590582 | 3300009400 | Soil | VLLKIVYLLARRVLTLSVLLWRGDLAKDAELLVLR |
Ga0116854_10598353 | 3300009400 | Soil | VLLKIVYLLTCRVLGVAVLVFRGDRAKAAELLVLRHEN |
Ga0116854_10605672 | 3300009400 | Soil | MLLKIACLLMRWSFGLAVLVCRGDQAKNAGLLVLRHE |
Ga0116221_10377864 | 3300009523 | Peatlands Soil | LAGRVLLKIAYLLMRWTFGLAVLMFRGDQAKNAVKGH* |
Ga0116138_11047831 | 3300009552 | Peatland | LAGQVLLKIACLLMRWLFSLAVLVIRGDREKNAELLVLRHVGM |
Ga0116133_10390112 | 3300009623 | Peatland | LAGQVLLKIACLLMRWLFSLAVLVIRGDREKNAELLVLRHVGMVR* |
Ga0116125_11016821 | 3300009628 | Peatland | CLLMRWLFSLAVLVIRGDREKNAELLVLRHVGMVR* |
Ga0116121_11336051 | 3300009644 | Peatland | VLLKITYLLMRWTLGLAVLMFRGDRAKNAELPSAEG* |
Ga0116224_100335015 | 3300009683 | Peatlands Soil | VLPKIVYLLTCRVLSLAVLVFRGDLAKDAERLVLGHEN |
Ga0116130_10141511 | 3300009762 | Peatland | LAGQVLLKIACLLMRWLFSLAVRVIRGDREKNAELL |
Ga0116219_107510592 | 3300009824 | Peatlands Soil | VLLKIVYLLVRQVLGLAVLMFRGDGAKEAELLVLR |
Ga0116223_102745492 | 3300009839 | Peatlands Soil | VLLKIVYVLVRRLLSLAVLVFRGDRAKDAELLALRHA |
Ga0126373_103649813 | 3300010048 | Tropical Forest Soil | VRLKIVYLLMRWSFGLIALVLRGDSAKNAELLVLRHEN |
Ga0099796_101027202 | 3300010159 | Vadose Zone Soil | VLLKIVYLLTCRVLGLAVLMFRGDRAKDAELLVLRHQNA |
Ga0134084_103742152 | 3300010322 | Grasslands Soil | VLLKIAYLLTCRVLGVAVLVFGGDRAKDAELLVLRHEN |
Ga0074044_106644633 | 3300010343 | Bog Forest Soil | MLLKIVYQLTRRVLGLAVLAFRGDQAKDAELLALRHQNA |
Ga0126370_122576842 | 3300010358 | Tropical Forest Soil | LADQVLLKIVCLMMRWLFGLTVLVFRGDRTKNAELLVLR |
Ga0126379_100343001 | 3300010366 | Tropical Forest Soil | LADPVLLKIVCLMMRWLFGLTVLVFRGDQTKNAELLVLRHENAV |
Ga0126379_100498761 | 3300010366 | Tropical Forest Soil | LAGRVLLKIAYVLMCRMLGLVVLLCRDNQAKDAELLML |
Ga0126379_100725021 | 3300010366 | Tropical Forest Soil | LAGQVLLKIVCLMMRWLFGLTVLVFRGDQTKNAELLVLRHENAV |
Ga0134125_124756991 | 3300010371 | Terrestrial Soil | VLLKIVYLLTCRVLGVTVLVFRGDRAKAAELLVLRHENELYRNCER* |
Ga0134128_116453341 | 3300010373 | Terrestrial Soil | MWCWLACRVLLKIVYLLTCRVLGLAVPVFRGDLAKDAELL |
Ga0105239_125610462 | 3300010375 | Corn Rhizosphere | VLLTIVYLLVRRVLSLAVLLLRRDLAKEAELLALR |
Ga0136449_1010071812 | 3300010379 | Peatlands Soil | MLFKIVYLLVRRILGLAVLISRSDLAKDAELLVLR |
Ga0136449_1015421541 | 3300010379 | Peatlands Soil | LADRVLLKIVCLLMRWLFGLTVLVVRGDQAKNAEL |
Ga0136449_1015988921 | 3300010379 | Peatlands Soil | MWCWLACRVLLKIIYLLTCRVLGLAVLVFRGDLAKDAELLGSPA* |
Ga0136449_1040208143 | 3300010379 | Peatlands Soil | LWLADRVLLKIIYGLVCRLFSLAALMFRCDSAKDAELLVL* |
Ga0126361_103338932 | 3300010876 | Boreal Forest Soil | MLLKIVCPLTCRVLGMAVLAFRGDQAKAAELLVWGCR* |
Ga0137392_103424734 | 3300011269 | Vadose Zone Soil | VPLKIVYLLTCPVLGLAVVVFRGDRAKNAELLALRH |
Ga0137392_106614562 | 3300011269 | Vadose Zone Soil | VLLKISYLLMRWLFGLVVLVFRGDEAKDAELLVLRHE |
Ga0137383_107113553 | 3300012199 | Vadose Zone Soil | VLLKIVYLLIRRVLGLAVLVFRRDRAKDAELLVLRH |
Ga0137383_107501501 | 3300012199 | Vadose Zone Soil | MKIAYLLMRWFFGVVVLVFRGDRAKDAELLVLRMRTRCCAG |
Ga0137383_113383941 | 3300012199 | Vadose Zone Soil | MLLKIVYLLTCRVLGVAVLVFHGDRAKDAELPVLRHENA |
Ga0137381_108548932 | 3300012207 | Vadose Zone Soil | VLLNIVYLLTCRVLGLTVLVFRGDRTKDAELLVLRHE |
Ga0137378_100231349 | 3300012210 | Vadose Zone Soil | VLLNIVYLLTCRVLGLTVLVFPGDRTKDAELLVLRHEN |
Ga0137378_104361621 | 3300012210 | Vadose Zone Soil | LAGQVLLKIVCLLLRWLFGLAVLVARSDRAKDAELLVLRHENA |
Ga0137386_111007351 | 3300012351 | Vadose Zone Soil | MLLKIAYMLTRRLLDMAVLVFRGNQAKNAELLVLRHEN |
Ga0137384_101326005 | 3300012357 | Vadose Zone Soil | MLARLWLAGRVALKVVYLLTCRILGQAVLVFRGDRAKEAELLVL |
Ga0137384_101768763 | 3300012357 | Vadose Zone Soil | VLLKIVYLLTCRILGVAVLVFHGDRAKTAELLVLRH |
Ga0137413_103298051 | 3300012924 | Vadose Zone Soil | LAGQVQIKIAYLLMRWLFGLTVLVFRGDQAKNAELLVL |
Ga0157374_113295431 | 3300013296 | Miscanthus Rhizosphere | VLLTIVYLLVRRVLSLAVLLLRRDLAKEAELLALRHRPAGSR |
Ga0163162_102900413 | 3300013306 | Switchgrass Rhizosphere | VLLTIVYLLVRRVLSLAVLLLRRDLAKEAELLALRHRPAGSRL* |
Ga0181521_103057892 | 3300014158 | Bog | LTWGWLACRVLLKIVYLLTCRVLGLAVLVFRGDLA |
Ga0181532_103655682 | 3300014164 | Bog | VLLKIVYLLTRRVLGLAVLVFRGDRAKDAELLVLRHE |
Ga0181532_105549972 | 3300014164 | Bog | VLLKIAYLLMRWTLGLAVLMFRGDRAKNAELPSAEG* |
Ga0181526_102108742 | 3300014200 | Bog | LAGRVLLKIAYLLMRWTLGLAVLMFRGDRAKNAELPSAEG* |
Ga0182016_108189632 | 3300014493 | Bog | VLLKIVYLLTCRILGVAVLVFRGDRAKPAELRHENAVLRRHI |
Ga0182024_110845093 | 3300014501 | Permafrost | LADQVLLKIACLLMRWLFGLTVLGFRGDRAKSAELLVLRHEN |
Ga0132255_1063121861 | 3300015374 | Arabidopsis Rhizosphere | LADRVLLKIIYGLVRRLSSLAALRFRCDSAKDAELLVLRHEN |
Ga0181515_10774121 | 3300016730 | Peatland | VLLKITYMLMRWTFGLAVLMFRGDQAKNAELLVLRHENAVLR |
Ga0187812_10751871 | 3300017821 | Freshwater Sediment | VLLKIVYLLACRVLSLAVPVFRGNLAKDAELLVLRHENA |
Ga0187812_11179981 | 3300017821 | Freshwater Sediment | LAGRMLFKIVYLLVRRILGLAVLIFRSDLAKDAELLVL |
Ga0187812_12204152 | 3300017821 | Freshwater Sediment | VLLKIVYVLVRRLLSLAVLVFRGDRAKDAELLALRHEN |
Ga0187802_103183351 | 3300017822 | Freshwater Sediment | VLLKIAGVFTCRVLSLAVLAFRGNPAKDAGLLVLR |
Ga0187820_11540032 | 3300017924 | Freshwater Sediment | LAGRMLFKIVYLLVRRTLGLAVLISRSDLAKDAELLVL |
Ga0187820_12652361 | 3300017924 | Freshwater Sediment | VLLKIVYLLTCRVLGMVVLVFRGGLAKDAELLVLRDENA |
Ga0187807_10807061 | 3300017926 | Freshwater Sediment | VLLKIVYLLTCRVLSLAVLAFRGDLAKDAELLVLR |
Ga0187807_10852402 | 3300017926 | Freshwater Sediment | LAVRVLLKIVYLLTCRMLGAALLLFRSDRAKDAAEAATA |
Ga0187806_12550722 | 3300017928 | Freshwater Sediment | LLKIVYLLVRQLLSLAVLVLCGDRAKNAELLVLRH |
Ga0187801_101809271 | 3300017933 | Freshwater Sediment | MYLLTCRVLGLAVLVCRGDLAKDAELLALRHENAVL |
Ga0187879_100206202 | 3300017946 | Peatland | LAGRVLLKIAYLLMRWTLGLAVLMFRGDRAKNAELPSAEG |
Ga0187879_101354261 | 3300017946 | Peatland | LAGQVLLKIACLLMRWLFSLAVLVIRGDREKNAELLVLRHVGMVR |
Ga0187781_104669983 | 3300017972 | Tropical Peatland | LVCRVLLKIVYLLTCRVLGLAVLVFGGDRAKDAELLVLRHENAV |
Ga0187869_103165273 | 3300018030 | Peatland | VLLKITYLLMRWTFGLAVLMFHGDQAKNAELLVLRH |
Ga0187869_103197852 | 3300018030 | Peatland | VLLKIAYLLMRWTLGLAVLMFRGDRAKNAELPSAEG |
Ga0187867_102561551 | 3300018033 | Peatland | LACRVLLKIVYLFTCRVLGLAVLVFRSDLATDAELL |
Ga0187883_103556711 | 3300018037 | Peatland | LAGGVLLKSVYLVVRRPLGLAVLVLRTDLAKDAELLV |
Ga0187883_107749792 | 3300018037 | Peatland | LACRVLLKIVYLFTCRVLGLAVLVFRSDLAKDAELLVLR |
Ga0187871_100312321 | 3300018042 | Peatland | VLLKIVYLLTCRVLGLAVLVFRSDLAKDAELLVLRHE |
Ga0187890_108034261 | 3300018044 | Peatland | VLLKIVYLLACRVFGLALLVFRGDLAKDAELLVLRHENA |
Ga0193728_10041367 | 3300019890 | Soil | MLVKIVYLLMRWLFSLAARVFRGDRAKNAELLALR |
Ga0193728_10675173 | 3300019890 | Soil | VPLKIVYLLMRWLFGLVVLLSRGDRAKDAELLVLRHENA |
Ga0210403_112219772 | 3300020580 | Soil | LAGRMLFKIVYLLVRRILGLAVLISRSDLAKDAELLVL |
Ga0210397_103400671 | 3300021403 | Soil | LACRVQLKIVYVIVRRLLSLIVLVFRGDRAKDAELLVLRH |
Ga0210402_101703311 | 3300021478 | Soil | LADRVPLTIVYLLVRRVLSLAVLLSRRDLDKDAELL |
Ga0210402_120015371 | 3300021478 | Soil | VLLKIVYLLTCRALGLAVLVFRSDRAKDAGLLVLRHE |
Ga0208194_10748661 | 3300025412 | Peatland | LLKIACLLMRWLFSLAVLVIRGDREKNAELLVLRHVGMVR |
Ga0208479_10057623 | 3300025474 | Arctic Peat Soil | LAGRVLLKIVYLLMRWLFGLTVLVFRGDEARDTES |
Ga0208479_10591592 | 3300025474 | Arctic Peat Soil | LAGRVLLKIVYLLIRRLLGLAVLVFRKDLAKDAELL |
Ga0207928_10553541 | 3300025494 | Arctic Peat Soil | MLLTIVYLLVRRILGLAILVFRGDHAKDAELAILRH |
Ga0208356_10625352 | 3300025504 | Arctic Peat Soil | MLLKIVCLLMRWLFGLAVLVFRGDRAKNAELLVLRHE |
Ga0208356_10632211 | 3300025504 | Arctic Peat Soil | LADQVLVKLVCLLMRWLFSLAVLVIRGNRAKNAELLVSPA |
Ga0208586_100136512 | 3300025588 | Arctic Peat Soil | LADRVLLKIACLLMRWLFSLAVLVVRGDGEKNAELL |
Ga0208586_11204792 | 3300025588 | Arctic Peat Soil | VLLKIVYLLTCRVLGPAVLAFRGDRAKDAELLVLRH |
Ga0207930_10940731 | 3300025604 | Arctic Peat Soil | LTCRELLKIVYLLTCRVLGLAVLVFYGDLAKDAELLVVRHVAN |
Ga0208219_100047813 | 3300025625 | Arctic Peat Soil | VLLKIVCLLMRWLFSLAVLVSRGDGAKNAELLVLRHEN |
Ga0208219_10037466 | 3300025625 | Arctic Peat Soil | VLLKIACLLMRWSFSLAVLVVRGDRAKSAELLVLRHEN |
Ga0208219_10061135 | 3300025625 | Arctic Peat Soil | LACWVLLKIVYVLMRWLFSVTVLVFRGDEAKDAELLVLRHEN |
Ga0208220_10219801 | 3300025627 | Arctic Peat Soil | VLLKIACLLMRWLFSLAVLVVRGDGEKNAELLALRH |
Ga0208220_10916922 | 3300025627 | Arctic Peat Soil | VLLKIVCLLMRWLFGLAVLVSRGDGAKNAELLVLWHE |
Ga0208480_10025718 | 3300025633 | Arctic Peat Soil | MVGWRVLKIVYLLTCRVLGVAVLVFRSDRGNAAELLVLRH |
Ga0208480_10187634 | 3300025633 | Arctic Peat Soil | LAGGVLLKIACMLMRWSFGLAVLLFRGDQAENVELLV |
Ga0208480_10408942 | 3300025633 | Arctic Peat Soil | LAGRVLLKIVYLLTCRVLGVAVLVFRGDRAKAAELLVL |
Ga0208589_11301221 | 3300025634 | Arctic Peat Soil | LADRVLLKIVYLPTCRVLGVAVLVFRCERAKAAELLVL |
Ga0207700_108637471 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLKIVYLLTCRLLSLIVLVFRGDRAKDAGLLVLRH |
Ga0209890_100666282 | 3300026291 | Soil | VLLKIVYLLTCRILSLIAVLVRGSEAAAAEVLVPNLTR |
Ga0209839_102823033 | 3300026294 | Soil | LAGGVLLKIACMLMRWSFGLAVLLFRGDQAENVELLVLRHENAVLCRHAG |
Ga0209234_11953942 | 3300026295 | Grasslands Soil | LAGRVLLKIVCLLVRRILGLAVIVFRGDLAKDAELLV |
Ga0209239_12654381 | 3300026310 | Grasslands Soil | LAGRVLLKIAYVLTCRMLGLVVLLFRGDRAKDVELLV |
Ga0257173_10090333 | 3300026360 | Soil | LAGRLLLKVLYLLTCRLPGLADLVFRGDLAKDAGLLVLGHES |
Ga0257156_10027641 | 3300026498 | Soil | VLLKVAYLFMLGLIALVFRGDQAKDAELLVLRHENAVLRR |
Ga0179587_106857601 | 3300026557 | Vadose Zone Soil | VTWCWLACRVLLKIVYLLTCRVLGLAVLVFRGDLAKDAELLVVRHEALSVPDGGG |
Ga0179587_107596391 | 3300026557 | Vadose Zone Soil | LACRVLLKIVYLLTCRVLGLPVLVFRGDRAKDAELLV |
Ga0179587_108357651 | 3300026557 | Vadose Zone Soil | LAGRVLLKIVYLLTCRTLGLGVVLFRGDRATVAEVL |
Ga0207840_10248981 | 3300026910 | Tropical Forest Soil | VTWYWLACRVLLFKIVYLLTCRVLSLAVRVFRGDLAKDAEL |
Ga0208324_10261252 | 3300027604 | Peatlands Soil | VLLKIVYLLTCRVLGVAALVFRGDRAKTAELLVLRHED |
Ga0208696_12697512 | 3300027696 | Peatlands Soil | LAGRVLPKIVYLLTCRVLSLAVLVFRGDLAKDAELLVLRHE |
Ga0207862_10516611 | 3300027703 | Tropical Forest Soil | VTWYWLACRVLLFKIVYLLTCRVLSLAVRVFRGDLAKDAELLVLRHENA |
Ga0209656_100695861 | 3300027812 | Bog Forest Soil | VLLKILYVLVRRLLSLAVLVFRGDRAKDAELLVLRHK |
Ga0209656_100962631 | 3300027812 | Bog Forest Soil | VLLKIAYLLTCRMLGLAVLGFRSDRTKDVELLVLR |
Ga0209040_102428933 | 3300027824 | Bog Forest Soil | LAGRVPLKIVYLLVRRVLGLAVLVFRTDLAKDAEL |
Ga0209167_100312901 | 3300027867 | Surface Soil | MGCWLACRVLLKIVYVLRCRVLGLAVLVFGGDLAKDAELR |
Ga0189898_10401661 | 3300028450 | Peatlands Soil | VAGRVLLKIACVLTCRIRGLVVLMCRGDQAKDAELLV |
Ga0302202_103527372 | 3300028762 | Bog | LACRVLLKIVYLLTCRVLSLAVLVFRGGLAKDAELLVLRHEN |
Ga0307282_101704871 | 3300028784 | Soil | VLLKIVYLLTCRVPGPAVLVFRGDRTKAELLAHRHAWLEQA |
Ga0302157_100673474 | 3300028813 | Bog | VLLKITYLLMRWTFGLAVLMFHGDQAKNAELLVLRHENAVL |
Ga0302154_103102271 | 3300028882 | Bog | VLLKITYLLMRWTFGLAVLMFHGDQAKNAELLVLRHE |
Ga0311361_107820281 | 3300029911 | Bog | VLLKITYLLMRWTFGLAVLMFHGDQAKNAELLVLRHENAVLRRN |
Ga0311359_105673631 | 3300029914 | Bog | LACRVLLKIVYLLTCRVLSLAVLVFRGGLAKDAELL |
Ga0311371_112527141 | 3300029951 | Palsa | VLLKIVYLLTCRILGVAVLVFRGDRTMAAELLVVRGES |
Ga0311339_105948022 | 3300029999 | Palsa | LADRVLLKIVYLLVRRILGLAVLASRTDLAKDAELLYSGT |
Ga0302184_102455492 | 3300030490 | Palsa | LACRVLLKIVYLLTCRVLGLAVLVFRSDLAKDAELLVLRHE |
Ga0310037_103066991 | 3300030494 | Peatlands Soil | LAGRVLPKIVYLLTCRVLSLAVLVFRGDLAKDAELLVLRH |
Ga0311370_102961703 | 3300030503 | Palsa | VLLKIVYLLTCRVLSLAVLVFRGGLAKDAELLVLRHE |
Ga0311356_101934982 | 3300030617 | Palsa | VLLKIVYLLTCRVLSLAVLVFRGDPAKDAELLVLRA |
Ga0210279_104054582 | 3300030631 | Soil | LAGRVLLKIVYLLVRQILGLAVLVLRKDLAKDAELLVL |
Ga0310039_100181956 | 3300030706 | Peatlands Soil | VLPKIVYLLTCRVLSLAVLVFRGDLAKDAELLVLWHENA |
Ga0265461_129567642 | 3300030743 | Soil | LAGRVLLKIVYLLVRQILGLAVLVLRKDLAKDAELLVLRSGPPSIN |
Ga0318516_105785232 | 3300031543 | Soil | VTRYWLACRVLLKIAYLLTCRVLGLAVLVFRRDLAKD |
Ga0318516_105813291 | 3300031543 | Soil | VLLEIVYLLVRRVLGFAVLVFRRDLTKDAELLALRHEN |
Ga0318534_104195432 | 3300031544 | Soil | VIFTSVYLIVRSVPGLLAMRFRRDLSKDAELLVLRHR |
Ga0318573_107102881 | 3300031564 | Soil | VLLKIAYVLTCRMLGLVILLCRDDRVKDAELLMLRHENAVL |
Ga0310686_1065557402 | 3300031708 | Soil | LACGVLLKIAYLLTCRMLGLAVLGFCSDRTKDVELLVLRHENA |
Ga0310686_1192520541 | 3300031708 | Soil | VLLKIVWLLMRWLFSLAGLMCRGDGAKDAELLVLRHENAVL |
Ga0310686_1196977781 | 3300031708 | Soil | LAGRVLLKILYLLTCRVLSVAVMVFRGDRVQAAELLFLRHEN |
Ga0318494_104268532 | 3300031751 | Soil | WLACGVLLKIVYLLTCRVLGLAVLMFRGDRAKDSELLVLQDS |
Ga0306925_120938241 | 3300031890 | Soil | VLLKIIYLLVRRLFSLVVLIHRCDSAKDAELLVLRH |
Ga0306923_119460221 | 3300031910 | Soil | LAGRVLLEIVYLLVRRVLGFAVLVFRRDLTKDAELLAL |
Ga0310910_115718921 | 3300031946 | Soil | VLLKIIYLLVRRLFSLVVLIHRCDSAKDAELLVLRHEN |
Ga0310911_108964481 | 3300032035 | Soil | VLLKIVYLLTCRVLGLAVVVFRGDRAKDAELLVLRHENA |
Ga0311301_103071161 | 3300032160 | Peatlands Soil | MWCWLACRVLLKIIYLLTCRVLGLAVLVFRGDLAKDAELLGSPA |
Ga0311301_107610221 | 3300032160 | Peatlands Soil | RLWLADRVLLKIIYGLVCRLFSLAALMFRCDSAKDAELLVL |
Ga0307472_1007024221 | 3300032205 | Hardwood Forest Soil | VPLKIVYVLMRWLLGLVVLLSRGDRAEDAELLVLR |
Ga0306920_1007255831 | 3300032261 | Soil | LAGLVLLKIVYLLVRQVLGLAILMFRGDGAKEAELLVLRHENV |
Ga0306920_1023256641 | 3300032261 | Soil | MLLKIVYLLTCRVLCLAVLVFRGDLAKDADLLVLR |
Ga0348332_119343622 | 3300032515 | Plant Litter | LAGRVLLKIVYLLVRQILGLAVLVLRKDLAKDAELLVLRSGPPSI |
Ga0335085_117599182 | 3300032770 | Soil | MWCWLACRVLLKFVHVLVCRMLGVAVLVFRGDLAKDAELLVLRHEN |
Ga0335078_119352352 | 3300032805 | Soil | LANQVLLKIACLLMRWLLGLTVLVFRGDRANNAELLALR |
Ga0335081_126763022 | 3300032892 | Soil | LADRVLLKIVYLLVRRILGLAALVSRTDLAKDAEL |
Ga0335075_116694152 | 3300032896 | Soil | VLLKIVYLPVRRLLGLFVLLWREDLAKDAALTSSVS |
Ga0318519_110677821 | 3300033290 | Soil | LADRVPLTIVYLLVRRVLSLAVLLARRDLDKDAEL |
⦗Top⦘ |