NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F032517

Metagenome / Metatranscriptome Family F032517

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032517
Family Type Metagenome / Metatranscriptome
Number of Sequences 179
Average Sequence Length 124 residues
Representative Sequence SSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGAN
Number of Associated Samples 137
Number of Associated Scaffolds 179

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.25 %
% of genes near scaffold ends (potentially truncated) 62.57 %
% of genes from short scaffolds (< 2000 bps) 94.97 %
Associated GOLD sequencing projects 135
AlphaFold2 3D model prediction Yes
3D model pTM-score0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.883 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(57.542 % of family members)
Environment Ontology (ENVO) Unclassified
(78.212 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(47.486 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 5.06%    β-sheet: 0.00%    Coil/Unstructured: 94.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 179 Family Scaffolds
PF03078ATHILA 5.59


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.44 %
UnclassifiedrootN/A0.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004480|Ga0062592_102253241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum544Open in IMG/M
3300005331|Ga0070670_101209778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum690Open in IMG/M
3300005347|Ga0070668_101074661All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum725Open in IMG/M
3300005355|Ga0070671_100853154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum794Open in IMG/M
3300005367|Ga0070667_101070001All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum753Open in IMG/M
3300005438|Ga0070701_10458454All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum820Open in IMG/M
3300005466|Ga0070685_11144246All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum589Open in IMG/M
3300005467|Ga0070706_100437493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1217Open in IMG/M
3300005615|Ga0070702_101078274All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum640Open in IMG/M
3300005615|Ga0070702_101126180All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum629Open in IMG/M
3300005617|Ga0068859_101799483All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum676Open in IMG/M
3300005618|Ga0068864_101351617All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum713Open in IMG/M
3300005618|Ga0068864_102605578All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300005719|Ga0068861_101225998All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum726Open in IMG/M
3300005841|Ga0068863_102697132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300005842|Ga0068858_100965329All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum834Open in IMG/M
3300009092|Ga0105250_10617102All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum504Open in IMG/M
3300009101|Ga0105247_10101980All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1836Open in IMG/M
3300009553|Ga0105249_11643640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum715Open in IMG/M
3300009553|Ga0105249_12213282All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300009872|Ga0130079_14153804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum527Open in IMG/M
3300009971|Ga0105127_10070All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2097Open in IMG/M
3300009971|Ga0105127_12027All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum558Open in IMG/M
3300009972|Ga0105137_101709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum849Open in IMG/M
3300009973|Ga0105136_101856All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum988Open in IMG/M
3300009973|Ga0105136_102569All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum895Open in IMG/M
3300009973|Ga0105136_106102All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum685Open in IMG/M
3300009973|Ga0105136_108285All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300009975|Ga0105129_101672All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1013Open in IMG/M
3300009975|Ga0105129_102223All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum942Open in IMG/M
3300009976|Ga0105128_104452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum807Open in IMG/M
3300009977|Ga0105141_106156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1020Open in IMG/M
3300009977|Ga0105141_121570All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum567Open in IMG/M
3300009978|Ga0105148_109758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum727Open in IMG/M
3300009980|Ga0105135_109852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum719Open in IMG/M
3300009980|Ga0105135_129861All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum511Open in IMG/M
3300009981|Ga0105133_115538All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum629Open in IMG/M
3300009984|Ga0105029_113882All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum636Open in IMG/M
3300009984|Ga0105029_117079All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum592Open in IMG/M
3300009985|Ga0105036_113873All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum708Open in IMG/M
3300009989|Ga0105131_117708All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum679Open in IMG/M
3300009990|Ga0105132_115617All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum701Open in IMG/M
3300009992|Ga0105120_1011351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum878Open in IMG/M
3300009993|Ga0105028_103661All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1605Open in IMG/M
3300009995|Ga0105139_1078973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300010371|Ga0134125_12328981All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum582Open in IMG/M
3300010373|Ga0134128_10582969All Organisms → Viruses → Predicted Viral1245Open in IMG/M
3300010396|Ga0134126_11520047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica738Open in IMG/M
3300010396|Ga0134126_12794567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum529Open in IMG/M
3300010397|Ga0134124_10795622All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum944Open in IMG/M
3300010399|Ga0134127_13384593All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum522Open in IMG/M
3300010400|Ga0134122_10578925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1033Open in IMG/M
3300010401|Ga0134121_12452276All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum563Open in IMG/M
3300010401|Ga0134121_13234522All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum504Open in IMG/M
3300010403|Ga0134123_10715636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum981Open in IMG/M
3300012949|Ga0153798_10199859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum722Open in IMG/M
3300013306|Ga0163162_10898313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum999Open in IMG/M
3300014325|Ga0163163_10698165All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1078Open in IMG/M
3300014326|Ga0157380_11492805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum729Open in IMG/M
3300014326|Ga0157380_12092586All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum629Open in IMG/M
3300014968|Ga0157379_11019713All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum790Open in IMG/M
3300014968|Ga0157379_12658381All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica502Open in IMG/M
3300015273|Ga0182102_1002837All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1020Open in IMG/M
3300015273|Ga0182102_1018841All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum642Open in IMG/M
3300015273|Ga0182102_1044982All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300015278|Ga0182099_1012482All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum814Open in IMG/M
3300015280|Ga0182100_1002351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1519Open in IMG/M
3300015280|Ga0182100_1035533All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum712Open in IMG/M
3300015284|Ga0182101_1060327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum600Open in IMG/M
3300015293|Ga0182103_1058140All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum610Open in IMG/M
3300015297|Ga0182104_1025228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum850Open in IMG/M
3300015297|Ga0182104_1037664All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum751Open in IMG/M
3300015306|Ga0182180_1028644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum773Open in IMG/M
3300015306|Ga0182180_1050698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum630Open in IMG/M
3300015309|Ga0182098_1085670All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum582Open in IMG/M
3300015310|Ga0182162_1111515All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum533Open in IMG/M
3300015312|Ga0182168_1079174All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300015315|Ga0182120_1078752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum628Open in IMG/M
3300015315|Ga0182120_1120367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum533Open in IMG/M
3300015316|Ga0182121_1015998All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1111Open in IMG/M
3300015316|Ga0182121_1073032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum665Open in IMG/M
3300015319|Ga0182130_1063087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum668Open in IMG/M
3300015320|Ga0182165_1012449All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1185Open in IMG/M
3300015320|Ga0182165_1065041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum691Open in IMG/M
3300015326|Ga0182166_1108826All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum563Open in IMG/M
3300015327|Ga0182114_1150266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica519Open in IMG/M
3300015328|Ga0182153_1034406All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum862Open in IMG/M
3300015330|Ga0182152_1022840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum999Open in IMG/M
3300015333|Ga0182147_1072469All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum708Open in IMG/M
3300015334|Ga0182132_1083906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum672Open in IMG/M
3300015336|Ga0182150_1162904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum507Open in IMG/M
3300015338|Ga0182137_1082034All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum700Open in IMG/M
3300015338|Ga0182137_1111577All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300015340|Ga0182133_1180540All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum516Open in IMG/M
3300015348|Ga0182115_1204177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum633Open in IMG/M
3300015349|Ga0182185_1073378All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum946Open in IMG/M
3300015349|Ga0182185_1136321All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum725Open in IMG/M
3300015349|Ga0182185_1174974All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum645Open in IMG/M
3300015350|Ga0182163_1286451All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum516Open in IMG/M
3300015352|Ga0182169_1153427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum752Open in IMG/M
3300015352|Ga0182169_1187569All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum676Open in IMG/M
3300015353|Ga0182179_1325962All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum501Open in IMG/M
3300015354|Ga0182167_1215101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum700Open in IMG/M
3300017408|Ga0182197_1037830All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum850Open in IMG/M
3300017412|Ga0182199_1198089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300017421|Ga0182213_1161820All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum632Open in IMG/M
3300017422|Ga0182201_1038974All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum782Open in IMG/M
3300017432|Ga0182196_1104195All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum580Open in IMG/M
3300017435|Ga0182194_1056388All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum730Open in IMG/M
3300017439|Ga0182200_1135239All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300017447|Ga0182215_1086999All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum689Open in IMG/M
3300017691|Ga0182212_1095389All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum666Open in IMG/M
3300017693|Ga0182216_1180296All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum549Open in IMG/M
3300017694|Ga0182211_1129085All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum598Open in IMG/M
3300025931|Ga0207644_11275019All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300025936|Ga0207670_11108832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum668Open in IMG/M
3300026035|Ga0207703_10706827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum959Open in IMG/M
3300026884|Ga0207455_1006846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum589Open in IMG/M
3300028051|Ga0268344_1007939All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum721Open in IMG/M
3300028053|Ga0268346_1010849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum776Open in IMG/M
3300028053|Ga0268346_1044859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300028139|Ga0268355_1016876All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum523Open in IMG/M
3300028142|Ga0268347_1007779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum790Open in IMG/M
3300028150|Ga0268343_1003774All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum886Open in IMG/M
3300028466|Ga0268321_100381All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1353Open in IMG/M
3300028525|Ga0268305_102146All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum861Open in IMG/M
3300028529|Ga0268311_1002664All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1039Open in IMG/M
3300032465|Ga0214493_1064699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum869Open in IMG/M
3300032466|Ga0214503_1019796All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1807Open in IMG/M
3300032468|Ga0214482_1053119All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum783Open in IMG/M
3300032468|Ga0214482_1097696All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum555Open in IMG/M
3300032490|Ga0214495_1011304All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1779Open in IMG/M
3300032502|Ga0214490_1060567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum863Open in IMG/M
3300032502|Ga0214490_1103571All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum650Open in IMG/M
3300032502|Ga0214490_1124952All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum585Open in IMG/M
3300032514|Ga0214502_1396587All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
3300032551|Ga0321339_1105349All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum640Open in IMG/M
3300032590|Ga0214489_1001162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae2461Open in IMG/M
3300032591|Ga0214484_1082271All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum674Open in IMG/M
3300032689|Ga0214497_1082049All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum709Open in IMG/M
3300032689|Ga0214497_1097651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum639Open in IMG/M
3300032697|Ga0214499_1230964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum571Open in IMG/M
3300032698|Ga0214485_1048255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum818Open in IMG/M
3300032699|Ga0214494_1087087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum590Open in IMG/M
3300032757|Ga0314753_1036874All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum888Open in IMG/M
3300032761|Ga0314733_1005284All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1885Open in IMG/M
3300032761|Ga0314733_1103628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300032789|Ga0314725_1045059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
3300032791|Ga0314748_1033942All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1068Open in IMG/M
3300032791|Ga0314748_1047706All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum910Open in IMG/M
3300032792|Ga0314744_1073292All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum661Open in IMG/M
3300032811|Ga0314718_1003624All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1607Open in IMG/M
3300032821|Ga0314719_1000535All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae2852Open in IMG/M
3300032827|Ga0314730_111911All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum938Open in IMG/M
3300032827|Ga0314730_138775All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300032888|Ga0314728_101761All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1575Open in IMG/M
3300032889|Ga0314751_1015229All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1422Open in IMG/M
3300032889|Ga0314751_1034790All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1012Open in IMG/M
3300032890|Ga0314747_1030712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum810Open in IMG/M
3300032914|Ga0314750_1030261All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1197Open in IMG/M
3300032915|Ga0314749_1009986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1735Open in IMG/M
3300032915|Ga0314749_1045269All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum944Open in IMG/M
3300032916|Ga0314734_1105979All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum550Open in IMG/M
3300032916|Ga0314734_1120562All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300032966|Ga0314722_1007909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1487Open in IMG/M
3300033523|Ga0314768_1015498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2120Open in IMG/M
3300033523|Ga0314768_1016027All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2094Open in IMG/M
3300033525|Ga0314758_1025590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1594Open in IMG/M
3300033525|Ga0314758_1188912All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum559Open in IMG/M
3300033526|Ga0314761_1096673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum656Open in IMG/M
3300033526|Ga0314761_1155856All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum501Open in IMG/M
3300033530|Ga0314760_1137134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum599Open in IMG/M
3300033531|Ga0314756_1004235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2144Open in IMG/M
3300033535|Ga0314759_1069788All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1076Open in IMG/M
3300033537|Ga0314766_1005950All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2906Open in IMG/M
3300033539|Ga0314762_1009341All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1669Open in IMG/M
3300033542|Ga0314769_1014716All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2022Open in IMG/M
3300033542|Ga0314769_1144288All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum795Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere57.54%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated11.73%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.59%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere5.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.35%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.12%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.12%
Switchgrass DegradingEngineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading1.12%
RumenHost-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.56%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.56%
Switchgrass LeafHost-Associated → Plants → Phylloplane → Endophytes → Unclassified → Switchgrass Leaf0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009872Cow rumen microbiome (microbial/fungal) from cows held on UI at Urbana campus farm, Champaign, IL - Switchgrass. Combined Assembly of Gp0148675, Gp0148676Host-AssociatedOpen in IMG/M
3300009971Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_174 metaGHost-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009973Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaGHost-AssociatedOpen in IMG/M
3300009975Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaGHost-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009977Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaGHost-AssociatedOpen in IMG/M
3300009978Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009984Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaGHost-AssociatedOpen in IMG/M
3300009985Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_101 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009993Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010267Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 12_48_3.3_201_A2 metaGEngineeredOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012949Switchgrass enrichment cultures co-assemblyEngineeredOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05K5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300028051Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028053Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028139Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028142Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028150Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028466Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028525Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028529Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032468Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032514Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032590Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032689Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032698Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032757Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032761Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032789Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032792Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032811Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032821Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032827Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032888Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032889Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032890Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032914Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032915Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032916Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032966Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033523Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033525Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033526Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033530Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033531Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033535Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033537Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033539Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033542Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062592_10225324113300004480SoilYSEFLGLYGGGADDLVERRGGGGIPLENLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRQENNISKSGTN*
Ga0070670_10120977823300005331Switchgrass RhizosphereMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRWENNISKSGTN*
Ga0070668_10107466123300005347Switchgrass RhizosphereDDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0070671_10085315413300005355Switchgrass RhizosphereSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLISPRSNMSLLGAGLSSSMLRGDSETECLCEELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0070667_10107000123300005367Switchgrass RhizosphereMVNPYSECLALYDDGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWKNNISKSGAN*
Ga0070701_1045845423300005438Corn, Switchgrass And Miscanthus RhizosphereSLPFMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVKLMEELLGSLIPPRSSMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0070685_1114424613300005466Switchgrass RhizosphereMNLSLSSSSFDKIINPYSEFLGFYGGGADDLVERHGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0070706_10043749333300005467Corn, Switchgrass And Miscanthus RhizosphereGGADDLVERRGGGGVPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLREELADASDVDERVLLLPVTNFMKPLMVTLCCTHSKTNTPGVSCRWENNISKSGAN*
Ga0070702_10107827423300005615Corn, Switchgrass And Miscanthus RhizosphereIINPYSEFLGLYGGGADDLVERRGGGGIPSVNRMEELLGSLIPPRSSMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0070702_10112618013300005615Corn, Switchgrass And Miscanthus RhizosphereRGGGGIPSVNLMEELLGSLIPPRSNMSLLGVGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNFMKPLMVTLCCTHSKTNTPGVSCRWENNISKSGAN*
Ga0068859_10179948323300005617Switchgrass RhizosphereMGLYGGGADDLVERRGGGGIPSVNLMEELLGFLIPPRSSMSLLGAGMSSSMLRGDSETECLREELADASDVNERVLLLPVTNLMMPLMVTPCCTHTKTNTPGVSCRRENNISKSGAN*
Ga0068864_10135161713300005618Switchgrass RhizosphereGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHTKTNTPGVSCRRENNISKSGAN*
Ga0068864_10260557823300005618Switchgrass RhizosphereMNLSLPSSSFDKMVNPYVDDLVERRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLREELADASDVDERVLLLPVTNFMKPLMVTLCCTHSKTNTPGVSCRWENNISKSGAN*
Ga0068861_10122599823300005719Switchgrass RhizospherePFMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVECRGGGGIPSVNLMEELLGSLIPPRSSMSLLGTGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0068863_10269713213300005841Switchgrass RhizosphereRGGGGIPSVNLMEELLGSLIPPRSNMSLLGVGLSSSMLRGDSETECLHEELADASGVDERILLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN*
Ga0068858_10096532923300005842Switchgrass RhizosphereMNLSLSSSYFDMMVNPYSDFLGLYGGGADDLVERRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLREELSDASNVDERVLLLPVTNFMKPLMVTLCCTHSKTNTPGVSCRWENNISKSGAN*
Ga0105250_1061710223300009092Switchgrass RhizosphereMVNPYSEYLGLYGGSADDLVERRGGGGIPSVNLMEELLRSLIPPRSNMSLLGAGLSSSMLCGDSETECLREELVDASDVDERVLLLPAMNFMRPLMVTPFCTHSKTNT
Ga0105247_1010198013300009101Switchgrass RhizosphereMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0105249_1164364023300009553Switchgrass RhizosphereMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGVGLSSTILRGDPENECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKTNTPGGFFAGGR
Ga0105249_1221328213300009553Switchgrass RhizosphereMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVECRGGGGIPSVNLMEELLGSLIPPRSSMSLLGTGLSSSMLLGNSETECLREERADASDVDERVLLLPVMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKS
Ga0130079_1415380423300009872RumenMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELPGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDECVLLLPAMNFMRPLMVTPCCTH*
Ga0105127_1007013300009971Switchgrass AssociatedLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPLVNLMKEVLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELGDASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0105127_1202713300009971Switchgrass AssociatedMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMHRGDPKTECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTQSKINTPRVS
Ga0105137_10170923300009972Switchgrass AssociatedMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERILLLPVTNFMKPLMVTLCCTHSKTNTPGVSCRWENNISKSGAN*
Ga0105136_10185623300009973Switchgrass AssociatedMNLSLSFSSFDKIINPYSELLGLYGGGADDLVARRGGGGIPSVNLMEELLGSLISPRSNMSLLGAGLSSSMLRGVPETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHTKTNTPGVSCRREDNISKSGAN*
Ga0105136_10256913300009973Switchgrass AssociatedMVNPYSECLGLYGGGAADLVERRGGGGIPSVNLMEELLGSLIPPRSNMLLLGAGLSSSMLRGDPETECLREELADALGVDERVLLLLVTNFMKPLMVTLCCTHSKINTPGVSCQLKSNISKSGAN*
Ga0105136_10610223300009973Switchgrass AssociatedVERHGGGGAPSVNLMEELLGSLIPQRSNMSLLGAGLSTSMPRGDSATECLREELSDASDVDERVLLLPVMDFMNPLMVTLCCTHSKTNTPGVSCRWENNISKSGAN*
Ga0105136_10828513300009973Switchgrass AssociatedLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0105129_10167213300009975Switchgrass AssociatedMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVEHRGGGGIPSVNRMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCIHSKTNTPGVSCRRENNISKSGTN*
Ga0105129_10222323300009975Switchgrass AssociatedMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLRKELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNISKNGAN*
Ga0105128_10445213300009976Switchgrass AssociatedMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEEPLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADTLGVDERVLLLPVTNFMKPLMVTLCCPHSKINTPGVSCRWENNISKSGAN*
Ga0105141_10615623300009977Switchgrass AssociatedMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSEIECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGAN*
Ga0105141_12157013300009977Switchgrass AssociatedMNLSLSSSSFDKMVNPYSDFLGLYGGGADDLVECRGGGGAPSVNLMEELLGFLIPPRSNMSLLGAGLSSSMLRGDPKTECIREELADASDVDEHVLLLPVTNFVKPLMVTLCCTHSKTIT
Ga0105148_10975813300009978Switchgrass AssociatedMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLHGDQETECLREELGDASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGAN*
Ga0105135_10985213300009980Switchgrass AssociatedMILSLSSSSIDKMVNPYSECLGLYGGGVDDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLSAGLSSFMLRGDPETECLRKELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKTGAN*
Ga0105135_12986123300009980Switchgrass AssociatedVERRGRGGTPSVNLMEELLGSLIPPRSNMSLLGAELSTSMPRGDSATECLREELDDASDVDEHVLLLPVTNFMKPLMVTLCCTHSKTNTPGVSCWWENNISKSGAN*
Ga0105133_11553813300009981Switchgrass AssociatedLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERILLLPVTNLMMPLMVTPCCTHTKTNTPGVSCRRENNISKSGAN*
Ga0105029_11388223300009984Switchgrass RhizosphereSLPFMNLSLSSSSIDKMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADALDVNECVLLLLATNLMMPLMVTPCFTHSKTNTPGVSCRRENNISKSGIN*
Ga0105029_11707913300009984Switchgrass RhizosphereADDLVECRGGGGIPLVNLMEELLGSLIPPRSSMSLLGAGLSSSMLRGDLETECLREELADASDVDERVLLLPVMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0105036_11387313300009985Switchgrass LeafMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDEHVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRKNN
Ga0105131_11770823300009989Switchgrass AssociatedMNLSLSSSSFDKMVNPYSDFLGLYGGGADDLVERRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLREELADASDVDERILLLPVTNFMKPLMVTLCCTHSKTNTPGVSCGWKNNISKSGAN*
Ga0105132_11561723300009990Switchgrass AssociatedMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGAPLVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLREELADASDVDERVLLLPLTNLMMPLMVTPC*
Ga0105120_101135123300009992Switchgrass AssociatedMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKTNT
Ga0105028_10366123300009993Switchgrass AssociatedMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGVSETECLREELADASDVDECVLLLPAMNFMRSLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0105139_107897313300009995Switchgrass AssociatedMNLSLSSFSFDKMVNPYSDFLGLYGGGADDLVERRGGGGIPSDLMEELLGSPIPPRSNMSLRGAGLSSSMLRGDPETECLREELANASGVDERILLLPVTNFMKPLMATLCCTHSKTNTPGVSRQWKNNISKSGAN*
Ga0134101_104654213300010267Switchgrass DegradingMNLSLSSSSSDKIINPYSEFLGLYGGGADDLVKRRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADVSDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGFLAGGRTIYRRVE*
Ga0134125_1232898113300010371Terrestrial SoilMNLSLSSSSFDKMVNPYSDFLGLYGGGADDLVERRGGGGAPSVNIMEELLGSLIPPRSNMSLLGAGLSTSMPRGDLATECLRKELADVSDVDERILLRPVTNFMKPLMVTLCCTHSKTNTPGVSCQWENNISKSGAN*
Ga0134128_1058296923300010373Terrestrial SoilMNLSLSSSSFDKIINPYSKFLGLYGGGAYDHVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0134126_1152004723300010396Terrestrial SoilMNLSLSSSSFDKMVNPYSDFLGLYGGGADDLVERRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLREELSDASDVDERVLLLSVTNFMKPLMVTLCCTHSK
Ga0134126_1279456723300010396Terrestrial SoilMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISK
Ga0134124_1079562223300010397Terrestrial SoilMNLSLSSSSFDKMVNPYSDFLGLYGGGADDLVEHRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLCEELADVSDVDERVLLLPVTNFMKPLMVTLCCTHSKINTPAVYCRWKNNISKSGAN*
Ga0134127_1338459323300010399Terrestrial SoilMNLRFSSSSIDKMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSG
Ga0134122_1057892513300010400Terrestrial SoilSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSSMSLLGAGLSSSMLRGDSETECFREELADASDVDERVLLLPAMNFMRPLMVTLCCTH*
Ga0134121_1245227613300010401Terrestrial SoilDKILTPYSVFFGLPGGGADDLVEHRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCQRENNISKSGANWICGEFSEIFGVDFGGRIFQCSN*
Ga0134121_1323452213300010401Terrestrial SoilLPFMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSSMSLLGAGLSSSMLHGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0134123_1071563613300010403Terrestrial SoilMILSLSSSSIDKMVNPYSECLGLYGGGADDLVECRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSILRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN*
Ga0153798_1019985913300012949Switchgrass DegradingMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADVSDVDERVLLLPVTNLMMPLMVTPCCTH*
Ga0163162_1089831323300013306Switchgrass RhizosphereMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSSMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSK
Ga0163163_1069816523300014325Switchgrass RhizosphereVERRGGGGIPSVNLMEELLGSLIPPRSSMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGAN*
Ga0157380_1149280523300014326Switchgrass RhizosphereEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPWSNMSLLGAGLSSSMLHGDSETECLCEELGDASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0157380_1209258623300014326Switchgrass RhizosphereMNLSLSSSSFDKIVNPYSVFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVNPWCTHSKTNTPGVSCQRENNISKNGAN*
Ga0157379_1101971313300014968Switchgrass RhizosphereMVNPYSECLGLYGGGADDLVECCGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDEHVLLLPVTNFMKPLMATLCCTHSKINTPGVSCRWENNILKSGAN*
Ga0157379_1265838123300014968Switchgrass RhizosphereMNLSLSSSSFDKMVNPYSDFLGLYGGGADDLVERRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLRKELADASDVDERVLLLPVTNFMKPLMVTLCCTH*
Ga0182102_100283723300015273Switchgrass PhyllosphereMVNPYSDFLGLYGGGADDLVERRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLHEELADASDVDERVLLLPVMNLMMPLMVTPCCTHSKTNTPGVSCRWENNISKSGAN*
Ga0182102_101884113300015273Switchgrass PhyllosphereMNLSLSSSSFDKIINSYSEFLGLYGGGADDLVERRGGGGIPSVNVMEELLGSLIPPRSSMSLLGAGLSSSMLRGDSETECLCEELADASDVDERVLLLPVMNLMMPLMVTPCCTHTKTN
Ga0182102_104498213300015273Switchgrass PhyllosphereADDLVEHRGGGCAPSVNHMEELLGFLIPPRSNMSLLGAGLSTSMPRRDSATECLREDLSDASDVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWKNNISKSGAN*
Ga0182099_101248233300015278Switchgrass PhyllosphereGGGGIPSVNLMEELLGSLIPPRSNMSLFGAGLSSSMLRGDPETECLREELADASGVDERVLLLPMTNFMKPLMVNLCCTHSKTNTPGVTCQWKNNISKSGAN*
Ga0182100_100235123300015280Switchgrass PhyllosphereMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLDAGLSSSMLRGDPETECFREELADASGVDERVLLLPVTNFMKPLMVTPCCAHSKTNTLGVSCRWENNILKSGSN*
Ga0182100_103553323300015280Switchgrass PhyllosphereGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCWRENNISKSGTN*
Ga0182101_106032713300015284Switchgrass PhyllosphereMNLSLSSSSLDKIINPYSEFLGLYGGGADDLVERRGGDGIPSVNLMDELLGSLIPPRSHMSLLGAGLSSSMLRGDSETECLREELDDASDVDERVLLLPVTNLMMPLMVTPYCTHSKTNTPGVSCWRENNISKSGTD*
Ga0182103_105814013300015293Switchgrass PhyllosphereMNLSLSSSSFDKMVNPYSDFLGLYGGGADDLVERCGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLREELADASDVDERVLLLPVTNFMKPLMVTLCCTH*
Ga0182104_102522823300015297Switchgrass PhyllosphereMNLSLSSSSFDKIVNPYSEFLGLYGSGADDLVEHRGGGGAPLVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLREELSDASDVDERILLLPVTNFMKPLMVTLCCTHSKTNTPGVSCRWENNISKSGAN*
Ga0182104_103766413300015297Switchgrass PhyllosphereLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLISPRSSMSLLGAGLSSSMLRGGSETECLREELGDASDVDERVLLLPTMNFMRPLVVTPCCTHSKTNTPGVSCRWENNISKSGAN*
Ga0182180_102864413300015306Switchgrass PhyllosphereVNTYSEFLGLYGGGADDLVECHGGGGAPSVNLMEKLLGSLIPPRSNMSLLGAGLSTSMPCGDSATECLREELADASDVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN*
Ga0182180_105069813300015306Switchgrass PhyllosphereMNLSLSSSSFDKMVNPYSDFLGLYGGGADDLVERRGGGGAPSVNLMEELLGSLIRPRSNMSLLSAGLSTSMPRRDSATECLREELADASDVDKRVLLLPVTNFMKPLMVTLCCTH*
Ga0182098_108567013300015309Switchgrass PhyllosphereRSLPFMNLSLSSSSFDKIINPYSEFLGLYGGDADDLVERRGGGGIPSVNLMEEFLGSLIPPRSNMLLLGAGLSSSMLRGDSETEWLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNISKSGAN*
Ga0182162_111151513300015310Switchgrass PhyllosphereVERCGGGGIPSVNLMEELLGPLIPPRTNMSLLGAGLSSSMLRGDSETECLREELANASDVYERVLLLPAMNFMRRLMVTPCCTHTKKNTLRVSCRW*
Ga0182168_107917413300015312Switchgrass PhyllosphereLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0182120_107875213300015315Switchgrass PhyllosphereMNLSISSSSFDKIINPYSEFLGLYGGGADDLVEHRAGGGIPSMNLMEELLGSLIPPRSNMSLLGVGLSSSMLRRDSETECLREELADASDVDERILLLPVTNLMMPLMVTPCCTHSKTNTQRVSCRQENNISKSGIIMNCGEFSEIFEVNFGGRIFQGSN*
Ga0182120_112036713300015315Switchgrass PhyllosphereLYGGGADDLVECCGGGGIPSVNLMEELLGSLIPPRRSMSLLCAGLSSSMLRGDPKTECLREELADVSGVGERVLLLPVMNFMKPLMVTLCCTHSKINTPGVSCRWKNNISKSGAN*
Ga0182121_101599823300015316Switchgrass PhyllosphereRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN*
Ga0182121_107303223300015316Switchgrass PhyllosphereMNLSLSSSSFDKMVNPYSDFLGLYGGGADDLVERRGGGGPPSVNLMEELLGSLIPPRSNMLLLGAGLSTSMPRGDSATECLREELSDASDVDERVLLLPVTNFMKPLMVTLCCTHS
Ga0182130_106308723300015319Switchgrass PhyllosphereMNLSISSSSFDKMVNPYSDFLSLYGSGADDLAERRGGGGALSVNLMEELLGSLIPPRSNMPLLGAGLSTSMPRRDSATECLREELSDALDVDERVLLLLVTNFMKPLMVTLCCTHSKTNTPGVSCRWENNISKS
Ga0182165_101244923300015320Switchgrass PhyllosphereMNLSLSSSSIDKMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN*
Ga0182165_106504113300015320Switchgrass PhyllosphereMNLRLSSSSFDKMVNPYSDFLGLYGGGADDLVERRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLREELSDALDVDERVLLLLVTNFMKPLMVTLCSTHSKTNTPG
Ga0182166_110882623300015326Switchgrass PhyllosphereMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSC
Ga0182114_115026613300015327Switchgrass PhyllosphereMVNPYSDFLGLYGGGADDLVERRGGGGAPSVNLMEELLGSLIPPRSNMSLLGVGLSTSMPRGDSATECLREELSDASDVDERVLLLPVTNFMKPLIVTLCCTHSKTNTPGVSCRWENNISKSGAN*
Ga0182153_103440623300015328Switchgrass PhyllosphereMNLSLSSSSFNKMVNPYSDFLGLYGGGADDLVEHRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGQSTSMPRGDSATECLREELSDASDVDERVLLLPVTNFMKPLMVTLCCTHSKTNTPGVSCRWENNISKSGAN*
Ga0182152_102284013300015330Switchgrass PhyllosphereMVNPYSECLGLYGGGADDLVECRGGGGAPSVNLVEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLCEELADASDVDERVLLLPVTNFMKPLMVTLCSTHSKTNTPGVFLPVGEQYIEEWSKLGRRILP*
Ga0182147_107246913300015333Switchgrass PhyllosphereEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN*
Ga0182132_108390623300015334Switchgrass PhyllosphereDVVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGVGFSSSMLRGDSETECLREELGDALDVDEHVLLLLVTNLMIPLIVTPCCTHTKTNTPGGSCRRENNISKSGAN*
Ga0182150_116290413300015336Switchgrass PhyllosphereAHSLPFMNLSLSSSSIDKMVNPYSECLGLYGGGTDDLVERREAGGIPSVNLMEELLGSLIPSRSNMSLLGAGLSSSMLRGYPETECLREELADASGVDEHVLLLPVTNFMKPLMVPLCCTHSKINTPGVSCRWENNISKSGAN*
Ga0182137_108203413300015338Switchgrass PhyllosphereVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGARLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNISKSGAN*
Ga0182137_111157723300015338Switchgrass PhyllosphereGGADDLVERRGGGGIPSVNLMEELLRSLIPPMSNMSLLGAGLSSSMLRGDSETECLREELADVSDVNERVLLLPVTNLMMPLMVTPCCTHSKTNTPGFSCRRENNISKNGAN*
Ga0182133_118054023300015340Switchgrass PhyllosphereMNLSFSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLREELSDASDVDERVLLLPVTNFMKPLMVTLCC
Ga0182115_120417723300015348Switchgrass PhyllosphereMNLSLSSSSFDKIINPYYEFLGLYGGGVDDLVERREGGGIPSVNLMEQLLGSLIPPRSNMSLLGAGLSASMPHGDLATECLREELSDASDVDEHVLLLPVTNFMKPLMVTLWCTHSNINTPGVSCRWENNI*
Ga0182185_107337833300015349Switchgrass PhyllosphereSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELIGSLIPPRSNMSFLGAGLSSSMLHGDPETECLREELADASGVDERILLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN*
Ga0182185_113632113300015349Switchgrass PhyllosphereMVNPYLECLGLYGGGADDLVECRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKTNTPGVSCRWENNISKSGAN*
Ga0182185_117497413300015349Switchgrass PhyllosphereYFEFLGLYGGGADDLVERRGGGGIPSVNLIEELLGSLIPPRSNMSLLGTGLSSSMLRGDSETECLREEVADASDVDKRVLLLPVTNLMVPLMVTPCCTHTKTNTPGVSCRRENNISKSGAN*
Ga0182163_128645113300015350Switchgrass PhyllosphereSSSSIDKMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN*
Ga0182169_115342723300015352Switchgrass PhyllosphereMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLLVTNFMKPLMVTLCCTHSKINTPGVSSWWENNISKRGAN*
Ga0182169_118756913300015352Switchgrass PhyllosphereDKMVNPYSDFLGLYGGGADDLVERRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLREELSDASDVDERVLLLPVTNFMKPLIVTLCCTHSKTNTSGVSCRWENNISKSGAN*
Ga0182179_132596213300015353Switchgrass PhyllosphereLPFMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVKSNGGGGIPSVNRMEELLGPLIPPRSNMSLIGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCQRKNNISKNGAN*
Ga0182167_121510123300015354Switchgrass PhyllosphereDLVERRGGGGIPSVNLMEELLGSFIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDEHVLLLPVTNFMKPLMVPLCCTHSKINTPGVSCRWENNISKSGAN*
Ga0182197_103783023300017408Switchgrass PhyllosphereMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLVEELLGSVIPPRSNMSLLGAGLSSSMLRGDPETEFLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN
Ga0182199_119808913300017412Switchgrass PhyllosphereFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDLETECLHEELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN
Ga0182213_116182013300017421Switchgrass PhyllosphereGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETESLREELADASDVDERILLLPVTNFMKPLMVTLCCTHSKTNTPGVSCRWENNISESGAN
Ga0182201_103897423300017422Switchgrass PhyllosphereMVNPYSDFLGLYGGGADDLVEHRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLREELSDASDVDERVLLLSVTNFMKPLMVTLCCTHSKTNTLGVSCRWENNISKSGAN
Ga0182196_110419523300017432Switchgrass PhyllosphereLYGGGADDLVERRGGCGAPSVNLMEELLGSLIPPRSNMSLLDVGLSTSMPRGDSATECLREELSDVSDVDERVLLLPVTNFMKPLMVTLCCTHSKTNT
Ga0182194_105638823300017435Switchgrass PhyllosphereMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMKELLGSLIPPRSNMSFLDAGLSSPMLREDPETECLREELADASGVDEHVLILPVTNFMKPLMVTLCYTHSKINTPGVSCRWENNISKSG
Ga0182200_113523913300017439Switchgrass PhyllosphereEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGTN
Ga0182215_108699913300017447Switchgrass PhyllosphereSLPFMNLSLSSSSIDKMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLCGDPETECLREELVDASGVDERILLLSVTNLMKPLMVTLCCTHSKINTPGVSGKWENNISMSGAN
Ga0182212_109538913300017691Switchgrass PhyllosphereSLPFMNLSLSSFSFDKMVNPYSDFLGLYGGGADDLVERRGGGGAPSVNLKEELLGSLIPPRNNMSLLGVGLSTSMARGGSATECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGISCRRENNISKSGTN
Ga0182216_118029613300017693Switchgrass PhyllosphereLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERILLLPVMNLMMPLMVTPCCTHSKTNTPEVSCRQENNISKSGAN
Ga0182211_112908513300017694Switchgrass PhyllosphereMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCYTHSKTNTPGVSCRWENNISKSGAN
Ga0207644_1127501913300025931Switchgrass RhizosphereEFLGLYGGGADDLVERRGGGGIPLVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN
Ga0207670_1110883213300025936Switchgrass RhizosphereINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASVVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGLSCRRENNISKSGTN
Ga0207703_1070682713300026035Switchgrass RhizospherePYSDFLGLYGGGADDLVERRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLREELSDASNVDERVLLLPVTNFMKPLMVTLCCTHSKTNTPGVSCRWENNISKSGAN
Ga0207455_100684613300026884SoilMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSCSMLREDSETECLREKHADASDVDERVLLLPVTNLMMPLMVTPCCTHSKINTPGVSCRRENNISKSGTN
Ga0268344_100793923300028051PhyllosphereADDLVEHRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKTNTPGVSCRWENNISKSGAN
Ga0268346_101084913300028053PhyllosphereYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSSMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGT
Ga0268346_104485913300028053PhyllosphereGGGADDLVERRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPCGDSATECLCEELVDVSGVDERVLLLPVMNFMKPLMVTLCCTHSKTNTSGVSCRWENNISKSGAN
Ga0268355_101687623300028139PhyllosphereMNLSLSSSSFDKMVNPYSDFLGLYGGGADDLVERRGGGGVPSVNLMEELLGSLIPPRSNMSLLGAGMSTSMPRGDSATECLREELADASDVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN
Ga0268347_100777923300028142PhyllosphereLSSSSIDKMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN
Ga0268343_100377413300028150PhyllosphereMNLSLSSSSFDKIINPYSEFLGLYGGGEDDLVERRGGGGAPSVNLMEELLGSLIPPRSNMSLLGAGLSTSMPRGDSATECLREELADASDVDERILLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN
Ga0268321_10038123300028466PhyllosphereMVNPYSDFLGLYGGGADDLVERRGGGGAPSVNLMEELLGSLIPPRSNMSLLGVGLSTSMPRGDSATECLREELADASDVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN
Ga0268305_10214613300028525PhyllosphereYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN
Ga0268311_100266413300028529PhyllosphereGGGGIPSVNLTEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN
Ga0214493_106469913300032465Switchgrass PhyllosphereMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERHGGGDIPSVNLMEELLGSLIPPRSNMSLLGVGLSSSMLCGDPETECLGEELADASGVDERVLLLLVTNFMKPLKVTL
Ga0214503_101979613300032466Switchgrass PhyllosphereLPFMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEEFLGSLIPPRSNMLLLGAGLSSSMLRGDSETEWLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNTSKSGAN
Ga0214482_105311913300032468Switchgrass PhyllosphereSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEEFLGSLIPPRSNMLLLGAGLSSSMLRGDSETEWLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNTSKSGAN
Ga0214482_109769613300032468Switchgrass PhyllosphereSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCPHTKTNTPGVSCRRENNISKSGAN
Ga0214495_101130413300032490Switchgrass PhyllosphereIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEEFLGSLIPPRSNMLLLGAGLSSSMLRGDSETEWLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNTSKSGAN
Ga0214490_106056733300032502Switchgrass PhyllosphereADDLVERRGGGGIPLVNLMEELLGSLIPLRRNMSLLGAGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKLLMVTLCCTHSKINTPGVSCRWENNISKSGAN
Ga0214490_110357113300032502Switchgrass PhyllosphereMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVEHRGGGDIPSMNLMEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETEWLREELADASDVDERVLLLPMTNLMMPLMVTPCCTHSKTNTSGVSCRRENNISKSGAN
Ga0214490_112495213300032502Switchgrass PhyllosphereMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVKRRGGGDIPSVNLMEELLGSLISPRSSMSLLDAGLSSYMLRGDSETDCLREELADASDVDESVLLLPVMNLMMPLMVTPYCTH
Ga0214502_139658713300032514Switchgrass PhyllosphereLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMLLLGAGLSSSLLRGDSEIECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRWENNISKSGAN
Ga0321339_110534913300032551Switchgrass PhyllosphereSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPYCTH
Ga0214489_100116213300032590Switchgrass PhyllosphereGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETEWLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNTSKSGAN
Ga0214484_108227113300032591Switchgrass PhyllosphereMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMLLLGAGLSSSLLRGDSEIECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRWENNISKSGAN
Ga0214497_108204913300032689Switchgrass PhyllosphereMNLSLSSSSFDKIINPYSEFLDLYGGGADDLVERRGGGGIPSVDLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDPETECLREELADASGVDERILLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGTNWELW
Ga0214497_109765113300032689Switchgrass PhyllosphereSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPYCTH
Ga0214499_123096413300032697Switchgrass PhyllosphereGCVDDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGVGLSSSMLCGDPETECLGEELADASGVDERILLLPVTNFMKPLMVTLCCTHSKINTPGVSYRWDNNISKSGAN
Ga0214485_104825513300032698Switchgrass PhyllosphereMNLSLSSSSFDKIINPYYEFLGLYGGGADDLVERRGGGGIPSVNLMEEFLGSLIPPRSNMLLLGAGLSSSMLRGDSETEWLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNTSKSGAN
Ga0214494_108708723300032699Switchgrass PhyllosphereVDDIVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETKCLREELADASDVDERVLLLPVTNFMKLLMVTLCCTHSKINTRGVSCRWENN
Ga0314753_103687413300032757Switchgrass PhyllosphereFLGLYGGGADDLVERRGGGGIPSVNLMKELLGSLIPPRSNMLLLGPGLSSSMLRGDPETECLREELADASGVDECVLLLPVTNFMKPLIVTLCCTHSKINTLGVSCRWENNISKSGAN
Ga0314733_100528423300032761Switchgrass PhyllosphereMNLSLSSSSFDKIINPYYEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNISKSGAN
Ga0314733_110362813300032761Switchgrass PhyllosphereGADDLVERRGGGGIPSVNRMEELLGSLIPPRSSMSLLGAGLSSSMLRGDSETEFLREELTDASDVDERVLLLPAINFMRPLMMTPCCTHSKINTPGVSCRRENNISKNGTN
Ga0314725_104505913300032789Switchgrass PhyllosphereSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGAN
Ga0314748_103394233300032791Switchgrass PhyllosphereERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGVGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCCTHSKINTPGVSCRWENNISKSGAN
Ga0314748_104770613300032791Switchgrass PhyllosphereSLSSSSIDKMVNPYSEYLSLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNTSKSGAN
Ga0314744_107329213300032792Switchgrass PhyllosphereMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPYCTH
Ga0314718_100362413300032811Switchgrass PhyllosphereMNLSISYSSFDKIINPYSEFLGLYGGGADDLVEHCGGGGIPSVNLIEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCPHTKTNTPGVSCRRENNISKSGAN
Ga0314719_100053523300032821Switchgrass PhyllosphereMNLSLSSSSFDKIINPYYEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPFCTHSKTNTPGVSCRRENNISTSGAN
Ga0314730_11191123300032827Switchgrass PhyllosphereMNLSLSSSSFDKIINPYYEFLGLYGGGADDLVERRGGGIPSVNLMEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNISKSGAN
Ga0314730_13877513300032827Switchgrass PhyllosphereMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGVGLSSSMLRGDPETECLREELADASGVDERVLLLPVTNFMKPLMVTLCYTHSKINTLGVSCQWENNISKSGAN
Ga0314728_10176113300032888Switchgrass PhyllosphereMNLSLSSSSFDKIINPYYEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPYCTH
Ga0314751_101522913300032889Switchgrass PhyllosphereIINPYSEFLGLYGDGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPYCTH
Ga0314751_103479013300032889Switchgrass PhyllosphereLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSVLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCQRENNISKSGTN
Ga0314747_103071213300032890Switchgrass PhyllosphereSLPFMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEEFLGSLIPPRSNMLLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNTSKSGAN
Ga0314750_103026113300032914Switchgrass PhyllosphereLPFMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPYCTH
Ga0314749_100998613300032915Switchgrass PhyllosphereWACIGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLSEELTDASDVDERVLLLPAMNFMRALMVTPCCTHSKTNTPGVSCRRENNISKSGTN
Ga0314749_104526913300032915Switchgrass PhyllosphereKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNTSKSGAN
Ga0314734_110597913300032916Switchgrass PhyllosphereFARSLPFMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERCGGGGIPSVNLMEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNISKSGAN
Ga0314734_112056213300032916Switchgrass PhyllosphereFARSLPFMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSVLRGDSETECLREELADASDVDERVLLLPVMNLMMPLMVTPYCTH
Ga0314722_100790913300032966Switchgrass PhyllosphereMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSVLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNTSKSGAN
Ga0314768_101549813300033523Switchgrass PhyllosphereMNLSLSSSSFDKIINPYYEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNTSKSGAN
Ga0314768_101602713300033523Switchgrass PhyllosphereRRGGGGIPSVNLMEELLGSLIPPRSSIPLLSAGLSSSMLRGDSETECLSEELTDASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSWRRENNISKSGTN
Ga0314758_102559013300033525Switchgrass PhyllosphereMNLSLSSSSFDKIINPYYEFLGLYGGGADDLVERRGGGIPSVNLMEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLLVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNISKSGAN
Ga0314758_118891223300033525Switchgrass PhyllosphereNLSLSSSSIDKMVNPYSECLGLYGGGADDLVERRGGDGIPSVNLMEELLGSLIPPRSNMSLLGVGLSSSMLRGDPETECLREEPADASGVDERVLLLPVTNFMKPLMVTFCCTHSKINTPGVSCRWENNISKSRAN
Ga0314761_109667313300033526Switchgrass PhyllosphereMVNPYSECLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGVGLSSSMLCGDPETECLREELADASGVDERVLLLPVTNLMMPLMVTPCCPHTKTNTPGVSCRRENNISKSGAN
Ga0314761_115585613300033526Switchgrass PhyllosphereGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETEWLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNTSKSGAN
Ga0314760_113713413300033530Switchgrass PhyllosphereMVNPYSDFLGLYGGGADGLVERHGGGVAPLVNLMEELLGSLIPPRSNMSLLSVGLSTSMPRGDSATECLREELADASGVDERVLLLPVKNFMRPLMVTLCCTHSKTNTPGVSCRRENNTSKSGAN
Ga0314756_100423513300033531Switchgrass PhyllosphereERRGGGGIPSVNRMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRALMVTPCCTHSKTNTPGVSCRRENNISKSGAN
Ga0314759_106978823300033535Switchgrass PhyllosphereLPFMNLSLSSSSFDKIINPYSEFLGLYGGGADDLVERCGGGGIPSVNLMEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETEWLREELADASDVDERVLLLPMTNLMMPLMVTPCCTHSKTNTSGVSCRRENNISKSGAN
Ga0314766_100595013300033537Switchgrass PhyllosphereMNLSLSSSSFDKIINPYYEFLGLYGGGADDLVERRGGGGIPSVNLMEEFLGSLIPPRSNMLLLGAGLSSSMLRGDSETEWLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNISKSGAN
Ga0314762_100934113300033539Switchgrass PhyllosphereNPYSEFLGLYGGGADDLVEHCGGGGIPSVNLIEELLGSLIPPRSNMLLLGAGLSSSMLRGDSETEWLREELADASDVDERVLLLPVTNLMMPLMVTPCCTHSKTNTPGVSCRRENNISTSGAN
Ga0314769_101471623300033542Switchgrass PhyllospherePYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPYCTH
Ga0314769_114428813300033542Switchgrass PhyllosphereSSSSFDKIINPYSEFLGLYGGGADDLVERRGGGVIPSVNLMEELLGSLIPPRSSMSLLGAGLSSSMLRGDSETECLREELGDASDVDEHVLLLPAMNFRRPLMVTPCCTHSKTNTPGVSCWRENNISKNGAN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.