NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F032702

Metagenome Family F032702

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032702
Family Type Metagenome
Number of Sequences 179
Average Sequence Length 113 residues
Representative Sequence LDTQEVAVALEKTYVIVVRVVNFQGNKPIKDVNVKVFRLEKTPITLKQWAENLKNGTPFKRLILSMNTDNNGNVTAELAEGSYEVKVEKYGLNKVCELTQNDRVLFIEPKKHWWQ
Number of Associated Samples 128
Number of Associated Scaffolds 179

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 65.92 %
% of genes near scaffold ends (potentially truncated) 29.05 %
% of genes from short scaffolds (< 2000 bps) 79.33 %
Associated GOLD sequencing projects 119
AlphaFold2 3D model prediction Yes
3D model pTM-score0.74

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.363 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen
(11.732 % of family members)
Environment Ontology (ENVO) Unclassified
(37.430 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(29.050 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 9.09%    β-sheet: 36.36%    Coil/Unstructured: 54.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.74
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.3.5.1: Cna protein B-type domaind2pz4a22pz40.73307
b.3.5.0: automated matchesd3rkpa33rkp0.7171
b.3.5.1: Cna protein B-type domaind2pz4a12pz40.70457
b.3.5.0: automated matchesd3rkpa13rkp0.70355
b.3.4.0: automated matchesd4q14a_4q140.69282


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 179 Family Scaffolds
PF11946DUF3463 4.47
PF13676TIR_2 2.23
PF01037AsnC_trans_reg 1.68
PF00118Cpn60_TCP1 1.12
PF00535Glycos_transf_2 1.12
PF08818DUF1801 1.12
PF01297ZnuA 0.56
PF00072Response_reg 0.56
PF00719Pyrophosphatase 0.56
PF00808CBFD_NFYB_HMF 0.56
PF00582Usp 0.56
PF01145Band_7 0.56
PF04055Radical_SAM 0.56
PF00571CBS 0.56
PF00365PFK 0.56
PF13578Methyltransf_24 0.56
PF00383dCMP_cyt_deam_1 0.56
PF00156Pribosyltran 0.56
PF01040UbiA 0.56
PF02460Patched 0.56
PF13360PQQ_2 0.56
PF13588HSDR_N_2 0.56
PF03692CxxCxxCC 0.56
PF00005ABC_tran 0.56
PF01850PIN 0.56
PF12773DZR 0.56
PF01247Ribosomal_L35Ae 0.56
PF14329DUF4386 0.56
PF06197DUF998 0.56
PF08734GYD 0.56
PF04014MazE_antitoxin 0.56
PF00689Cation_ATPase_C 0.56
PF10604Polyketide_cyc2 0.56
PF00950ABC-3 0.56
PF06114Peptidase_M78 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 179 Family Scaffolds
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 1.12
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 1.12
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 1.12
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 1.12
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 0.56
COG0221Inorganic pyrophosphataseEnergy production and conversion [C] 0.56
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 0.56
COG0609ABC-type Fe3+-siderophore transport system, permease componentInorganic ion transport and metabolism [P] 0.56
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.56
COG1108ABC-type Mn2+/Zn2+ transport system, permease componentInorganic ion transport and metabolism [P] 0.56
COG2451Ribosomal protein L35AE/L33ATranslation, ribosomal structure and biogenesis [J] 0.56
COG3371Uncharacterized membrane proteinFunction unknown [S] 0.56
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.56
COG4606ABC-type enterochelin transport system, permease componentInorganic ion transport and metabolism [P] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.92 %
UnclassifiedrootN/A15.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000030|WSSedB1B_c000977All Organisms → cellular organisms → Archaea3939Open in IMG/M
3300001213|JGIcombinedJ13530_100209577Not Available982Open in IMG/M
3300001213|JGIcombinedJ13530_100418786All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1401Open in IMG/M
3300001213|JGIcombinedJ13530_101029204All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1024Open in IMG/M
3300001213|JGIcombinedJ13530_101210562All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium734Open in IMG/M
3300001213|JGIcombinedJ13530_101835661All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium541Open in IMG/M
3300001213|JGIcombinedJ13530_102555981All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium756Open in IMG/M
3300001213|JGIcombinedJ13530_104312318All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium782Open in IMG/M
3300001213|JGIcombinedJ13530_108774531Not Available650Open in IMG/M
3300001547|JGI20215J15232_1006431All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1774Open in IMG/M
3300001547|JGI20215J15232_1028957All Organisms → cellular organisms → Archaea → TACK group739Open in IMG/M
3300003432|JGI20214J51088_10003577All Organisms → cellular organisms → Archaea10232Open in IMG/M
3300003432|JGI20214J51088_10013033All Organisms → cellular organisms → Archaea5560Open in IMG/M
3300003432|JGI20214J51088_10122941All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1836Open in IMG/M
3300003432|JGI20214J51088_10147717All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1662Open in IMG/M
3300003432|JGI20214J51088_10237514All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1272Open in IMG/M
3300003432|JGI20214J51088_10371836All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium960Open in IMG/M
3300003432|JGI20214J51088_10866570All Organisms → cellular organisms → Archaea → TACK group589Open in IMG/M
3300003541|JGI20214J51650_10159740All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1548Open in IMG/M
3300003852|Ga0031655_10099735All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1172Open in IMG/M
3300004004|Ga0055451_10101898All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1140Open in IMG/M
3300004063|Ga0055483_10281108All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium549Open in IMG/M
3300004282|Ga0066599_100447443All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon821Open in IMG/M
3300005259|Ga0071344_1026471Not Available843Open in IMG/M
3300005831|Ga0074471_10986285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium500Open in IMG/M
3300005832|Ga0074469_10828465All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium604Open in IMG/M
3300006224|Ga0079037_101567323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium658Open in IMG/M
3300006642|Ga0075521_10153582All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1080Open in IMG/M
3300006950|Ga0075524_10297401All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium707Open in IMG/M
3300006950|Ga0075524_10506901All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium537Open in IMG/M
3300007918|Ga0111545_1003240All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia3782Open in IMG/M
3300009009|Ga0105105_10014273All Organisms → cellular organisms → Archaea → TACK group3246Open in IMG/M
3300009009|Ga0105105_10304054All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium862Open in IMG/M
3300009029|Ga0066793_10679634All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium585Open in IMG/M
3300009029|Ga0066793_10718890All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium567Open in IMG/M
3300009037|Ga0105093_10180413All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1076Open in IMG/M
3300009037|Ga0105093_10831031All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium539Open in IMG/M
3300009078|Ga0105106_10106282All Organisms → cellular organisms → Archaea → TACK group2065Open in IMG/M
3300009078|Ga0105106_11096050All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium565Open in IMG/M
3300009085|Ga0105103_10553573All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium650Open in IMG/M
3300009111|Ga0115026_10006972All Organisms → cellular organisms → Archaea4703Open in IMG/M
3300009111|Ga0115026_10171652All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1420Open in IMG/M
3300009146|Ga0105091_10285432All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium803Open in IMG/M
3300009153|Ga0105094_10642346All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium620Open in IMG/M
3300009165|Ga0105102_10266584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium877Open in IMG/M
3300009167|Ga0113563_12600047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium612Open in IMG/M
3300009171|Ga0105101_10063365All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1798Open in IMG/M
3300009179|Ga0115028_10069979All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1866Open in IMG/M
3300009179|Ga0115028_10204871All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1251Open in IMG/M
3300009502|Ga0114951_10001826All Organisms → cellular organisms → Archaea25318Open in IMG/M
3300009518|Ga0116128_1060995All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1169Open in IMG/M
3300009519|Ga0116108_1013035Not Available3027Open in IMG/M
3300009547|Ga0116136_1012216Not Available3080Open in IMG/M
3300009549|Ga0116137_1017707Not Available2719Open in IMG/M
3300009549|Ga0116137_1034029All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1764Open in IMG/M
3300009615|Ga0116103_1075842All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium892Open in IMG/M
3300009616|Ga0116111_1173352Not Available503Open in IMG/M
3300009629|Ga0116119_1004219Not Available4952Open in IMG/M
3300009631|Ga0116115_1182552Not Available530Open in IMG/M
3300009636|Ga0116112_1173394All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium599Open in IMG/M
3300009639|Ga0116122_1199753All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium626Open in IMG/M
3300009640|Ga0116126_1225374All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium595Open in IMG/M
3300009646|Ga0116132_1073501All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1069Open in IMG/M
3300009764|Ga0116134_1225577Not Available649Open in IMG/M
3300010341|Ga0074045_10022778All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota4867Open in IMG/M
3300010343|Ga0074044_10163852All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1485Open in IMG/M
3300012931|Ga0153915_11910279All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium695Open in IMG/M
3300013092|Ga0163199_1395450All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium513Open in IMG/M
3300014153|Ga0181527_1256357All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon704Open in IMG/M
3300014159|Ga0181530_10602608All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium537Open in IMG/M
3300014162|Ga0181538_10592241All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium579Open in IMG/M
3300014165|Ga0181523_10618147Not Available594Open in IMG/M
3300014256|Ga0075318_1004407All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1698Open in IMG/M
3300014256|Ga0075318_1126033All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium528Open in IMG/M
3300014257|Ga0075319_1081811All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium629Open in IMG/M
3300014490|Ga0182010_10267588All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon911Open in IMG/M
3300014490|Ga0182010_10378744All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium769Open in IMG/M
3300014491|Ga0182014_10129034All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1462Open in IMG/M
3300014494|Ga0182017_10699016All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium614Open in IMG/M
3300014498|Ga0182019_10157041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1445Open in IMG/M
3300014498|Ga0182019_10311446All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1052Open in IMG/M
3300014498|Ga0182019_11316283All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium534Open in IMG/M
3300014502|Ga0182021_10005689All Organisms → cellular organisms → Archaea14799Open in IMG/M
3300014502|Ga0182021_10011939All Organisms → cellular organisms → Archaea10321Open in IMG/M
3300014502|Ga0182021_10025063All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium7057Open in IMG/M
3300014502|Ga0182021_10028889All Organisms → cellular organisms → Archaea6546Open in IMG/M
3300014502|Ga0182021_10035598Not Available5845Open in IMG/M
3300014502|Ga0182021_10046061All Organisms → cellular organisms → Archaea5096Open in IMG/M
3300014502|Ga0182021_10138336All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium2832Open in IMG/M
3300014502|Ga0182021_10311485All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1856Open in IMG/M
3300014502|Ga0182021_10447683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1536Open in IMG/M
3300014502|Ga0182021_10732588All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1186Open in IMG/M
3300014502|Ga0182021_10756300All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1166Open in IMG/M
3300014502|Ga0182021_10864171All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1087Open in IMG/M
3300014502|Ga0182021_11486214All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium816Open in IMG/M
3300014838|Ga0182030_10637430All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1017Open in IMG/M
3300014839|Ga0182027_10144780All Organisms → cellular organisms → Archaea2805Open in IMG/M
3300014839|Ga0182027_10255385All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium2002Open in IMG/M
3300017925|Ga0187856_1074564All Organisms → Viruses → Predicted Viral1405Open in IMG/M
3300017929|Ga0187849_1026295Not Available3112Open in IMG/M
3300017929|Ga0187849_1030847All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium2762Open in IMG/M
3300017931|Ga0187877_1033402All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium2529Open in IMG/M
3300017935|Ga0187848_10000589All Organisms → cellular organisms → Archaea32709Open in IMG/M
3300017940|Ga0187853_10054001All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium2052Open in IMG/M
3300017973|Ga0187780_11216036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium552Open in IMG/M
3300017996|Ga0187891_1049919All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1759Open in IMG/M
3300018003|Ga0187876_1142383All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium846Open in IMG/M
3300018003|Ga0187876_1150105All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium815Open in IMG/M
3300018004|Ga0187865_1025423Not Available2676Open in IMG/M
3300018009|Ga0187884_10112499All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1174Open in IMG/M
3300018016|Ga0187880_1278692Not Available727Open in IMG/M
3300018017|Ga0187872_10281001All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium735Open in IMG/M
3300018019|Ga0187874_10000907All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota31724Open in IMG/M
3300018019|Ga0187874_10001184All Organisms → cellular organisms → Archaea25365Open in IMG/M
3300018019|Ga0187874_10001362All Organisms → cellular organisms → Archaea22654Open in IMG/M
3300018021|Ga0187882_1132045All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1031Open in IMG/M
3300018030|Ga0187869_10269016All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium823Open in IMG/M
3300018033|Ga0187867_10570103All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium620Open in IMG/M
3300018062|Ga0187784_10057926All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota3139Open in IMG/M
3300018086|Ga0187769_10054170Not Available2795Open in IMG/M
3300022555|Ga0212088_10003710All Organisms → cellular organisms → Archaea30004Open in IMG/M
3300023075|Ga0224520_1131758All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium549Open in IMG/M
3300024233|Ga0224521_1056185All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon872Open in IMG/M
3300025146|Ga0209322_10327772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium614Open in IMG/M
3300025152|Ga0208373_1231169All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium680Open in IMG/M
3300025162|Ga0209083_1001444All Organisms → cellular organisms → Archaea27107Open in IMG/M
3300025313|Ga0209431_10364150All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1122Open in IMG/M
3300025460|Ga0208562_1020261All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1599Open in IMG/M
3300025716|Ga0209746_1077509All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1051Open in IMG/M
3300025829|Ga0209484_10047675All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium927Open in IMG/M
3300025846|Ga0209538_1323337All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium536Open in IMG/M
3300025846|Ga0209538_1331450Not Available526Open in IMG/M
3300025852|Ga0209124_10194420All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium804Open in IMG/M
3300025864|Ga0209429_10223723Not Available754Open in IMG/M
3300025865|Ga0209226_10309059Not Available662Open in IMG/M
3300025888|Ga0209540_10035465All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium3086Open in IMG/M
3300025888|Ga0209540_10587957Not Available565Open in IMG/M
3300025888|Ga0209540_10661566All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium516Open in IMG/M
3300025891|Ga0209585_10071996All Organisms → cellular organisms → Archaea → TACK group1289Open in IMG/M
3300026353|Ga0256818_1014256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium691Open in IMG/M
(restricted) 3300026366|Ga0255362_1008172Not Available839Open in IMG/M
3300027675|Ga0209077_1102374All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium794Open in IMG/M
3300027723|Ga0209703_1090429All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1179Open in IMG/M
3300027762|Ga0209288_10192435All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium664Open in IMG/M
3300027877|Ga0209293_10300191All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium815Open in IMG/M
3300027877|Ga0209293_10352156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium756Open in IMG/M
3300027887|Ga0208980_10743597Not Available552Open in IMG/M
3300027890|Ga0209496_10445440All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium679Open in IMG/M
3300027896|Ga0209777_10165897All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1806Open in IMG/M
3300027897|Ga0209254_10449975Not Available942Open in IMG/M
3300027899|Ga0209668_10028035All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2856Open in IMG/M
3300027900|Ga0209253_10807684All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium666Open in IMG/M
3300027902|Ga0209048_10267214All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1211Open in IMG/M
3300028060|Ga0255359_123127All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium566Open in IMG/M
3300028069|Ga0255358_1043467All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium637Open in IMG/M
3300029984|Ga0311332_11537107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium540Open in IMG/M
3300030114|Ga0311333_11992096All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium507Open in IMG/M
3300031344|Ga0265316_10322058Not Available1123Open in IMG/M
3300031354|Ga0307446_1095243All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium825Open in IMG/M
3300031367|Ga0307440_1081805All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium938Open in IMG/M
3300031565|Ga0307379_11347892Not Available580Open in IMG/M
3300031673|Ga0307377_10611593All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon778Open in IMG/M
3300033408|Ga0316605_11698400All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium614Open in IMG/M
3300033413|Ga0316603_11414095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium659Open in IMG/M
3300033419|Ga0316601_100206192All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1730Open in IMG/M
3300033419|Ga0316601_101409951All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium701Open in IMG/M
3300033419|Ga0316601_102283749All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium545Open in IMG/M
3300033433|Ga0326726_10956193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium832Open in IMG/M
3300033486|Ga0316624_10196777All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1555Open in IMG/M
3300033486|Ga0316624_10260973All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1382Open in IMG/M
3300033487|Ga0316630_11670375Not Available579Open in IMG/M
3300033521|Ga0316616_100748754All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1179Open in IMG/M
3300033557|Ga0316617_102636327All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium523Open in IMG/M
3300033825|Ga0334843_051305All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium583Open in IMG/M
3300033977|Ga0314861_0172846All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1039Open in IMG/M
3300034128|Ga0370490_0093034All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium985Open in IMG/M
3300034128|Ga0370490_0304083All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium529Open in IMG/M
3300034169|Ga0370480_0289860All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium551Open in IMG/M
3300034195|Ga0370501_0200526Not Available703Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen11.73%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland10.61%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland10.06%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland8.38%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment7.82%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil7.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.59%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland3.91%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment3.35%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.35%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.23%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil2.23%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.12%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.12%
WetlandEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Wetland1.12%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.12%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.12%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.12%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.12%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.12%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.12%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.12%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.12%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.12%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.68%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.68%
Anaerobic Enrichment CultureEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.56%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.56%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.56%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.56%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.56%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.56%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.56%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.56%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000030Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 BulkEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001547Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site C1 BulkEnvironmentalOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003541Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003852Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HBEnvironmentalOpen in IMG/M
3300004004Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2EnvironmentalOpen in IMG/M
3300004063Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300005259Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid and Glucose under anaerobic conditions - HA Sample 1EnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005832Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBBEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300007918Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_2EnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300013092Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150mEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014256Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2EnvironmentalOpen in IMG/M
3300014257Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D1EnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300023075Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25EnvironmentalOpen in IMG/M
3300024233Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0EnvironmentalOpen in IMG/M
3300025146Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1EnvironmentalOpen in IMG/M
3300025152Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection C2 (SPAdes)EnvironmentalOpen in IMG/M
3300025162Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025716Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025829Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes)EnvironmentalOpen in IMG/M
3300025846Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025852Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes)EnvironmentalOpen in IMG/M
3300025864Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025865Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025891Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes)EnvironmentalOpen in IMG/M
3300026353Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PR4EnvironmentalOpen in IMG/M
3300026366 (restricted)Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T75.r2EnvironmentalOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027723Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027762Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028060Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T25EnvironmentalOpen in IMG/M
3300028069Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031354Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-20EnvironmentalOpen in IMG/M
3300031367Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-10EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300033825Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 1-5EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M
3300034169Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
WSSedB1B_00097733300000030WetlandMYIQVFAVSNPKVDQVIEKIYTLVVRVVNFKKIPIENVNVKIFRLEKEGITLNQWAENLRNGSPFKRLILSMNTDNNGNVSVELPEGVYEANAELYGLNNVCDLTQNAEILLVEPKKHWW
JGIcombinedJ13530_10020957723300001213WetlandLSKEVDVTLEKTYRLYVRVVDFQNKPKKNVNVKVFRLEKTPITLEQWAENIKNGSSLKRLMLSTNSDNEGKVTAELLEGSYEVKVEEYGLRKTCELTQNDSVLFVGPKKHWWQ*
JGIcombinedJ13530_10041878623300001213WetlandLEPIIEKKHSFNVRVVESRENKPIRDVNVKVFRLETEPISLKQWGENLKTGTPFKCLILSINTDNMGNVTADLPEGTYEAKVEKFNLIEVRELKQNTEILFIEPKKKWWR*
JGIcombinedJ13530_10102920413300001213WetlandLEKTYRLVVRVANFKGNRPIKNINVKVFRLEQESITLHQWAENLRNGSPFKSLVLSINTDNNGTVTAEVPEGVYEATAEKCGLTKICKLTKNAEVLLVEPKKHWWSDT*
JGIcombinedJ13530_10121056213300001213WetlandLESVLEKNYILVAKLVNFKSQPIQNVNIKVFKLENEPITLTQWAENLKDGAPNKRLILSMDTDVNGTVTVEVSEGVYEVKVEKYGLSKVCELAKNEEVLFVEPKVHWWQ*
JGIcombinedJ13530_10183566113300001213WetlandVSNPKVDQVIEKIYTLVVRVVNFKKIPIENVNVKIFRLEKEGITLNQWAENLRNGSPFKRLILSMNTDNNGNVSVELPEGVYEANAELYGLNNVCDLTQNAEILLVEPKKHWW*
JGIcombinedJ13530_10255598123300001213WetlandVKVVDFQRNEPIKNVNVKVFRLEKEPITPKQWAENLKNGTPFTRLIFSKNTGNDGNVIAELTEGVYEVKVEKYGLGTVYELTQNVEVLFIEPKKHWWQQSK*
JGIcombinedJ13530_10431231813300001213WetlandLEKTYRLIVRVGNFNENKPIKNVNVKVFRIEQESLNLKQWTENLKNGTPFKRLVLSMSTDNNGAVTVEFPEGVYEAKVEEYGLNKVCELKQNAEILFTEPKKRWW*
JGIcombinedJ13530_10877453133300001213WetlandVRAVNFQKDKPIKNINVKVFKLEKEPITVEQWAENIKNGASFKRLMLSKDTDDNGNVTAEFAKGVYEIHVENFGLKICELSQNTKILFVESKMHWWQ*
JGI20215J15232_100643123300001547WetlandLVTQEVDVHALEKTYVLVVRVVNFQRNEPIKDVNAKVSRLEKEPITLDQWAENLKDGTPFKRLILSVNPDNNGNVTAELAEGVYEVKVEKYGLNKVFELTQNNKVLFIEPKKHWWWIKF*
JGI20215J15232_102895713300001547WetlandLEKIANETTIETQKVDEISQKTYLLVVKVVNFQKNKPTKNATVKVFRLEKEPLTLKQWAENLKNGSPFKRLIVSMNTDNNGTVTVELAEGSYEVEEEKFGFNKVFDLTQNDE
JGI20214J51088_1000357763300003432WetlandVSTQKVDNVLEKTYVIVVRVVNFQRNKPIKNVNVKVFRLEKTPITLKQWAENLKNGTPFKRLILSMNTDNNGNVTAELAEGFYETKVEKYGLSKACELTKNDRVLFIEPKKHWWQ*
JGI20214J51088_1001303343300003432WetlandLEKIANETTIETQKVDEISQKTYLLVVKVVNFQKNKPTKNATVKVFRLEKEPLTLKQWAENLKNGSPFKRLIVSMNTDNNGTVTVELAEGSYEVEEEKFGFNKVFDLTQNDEILFIEPRKHWWH*
JGI20214J51088_1012294123300003432WetlandVSNQIVDKVLDKTYTLVVRVVNFKNGPIENVNVKIFRLETEGITLSQWAENLRNGSPFKRMILAKNTDNKGNLIAELPEGVYEAIAEKNCLNKVFDLTQHIEVLLIEPKKHWW*
JGI20214J51088_1014771713300003432WetlandVVDFQNKPKKNVNVKVFRLEKTPITLEQWAENIKNGSSLKRLMLSTNSDNEGKVTAELLEGSYEVKVEEYGLRKTCELTQNDSVLFVGPKKHWWQ*
JGI20214J51088_1023751423300003432WetlandLERIAHETTIEAQKVNEISQKTYLLVVKMVNFQKNKPTKNANVQVFRLEKEPIALKQWAENLKNGSPFKRLIVSMNTDDNGTATVKLAEGSYQVEVGEFGFNKFFELTQNDEILFIEPKKHWWH*
JGI20214J51088_1037183613300003432WetlandLERIAHETTIEAQKVDEISQKTYLLVIKVVNFQKNKPTKNANVSVFRLEKEPIALKQWAQNLKNGSPFKRLIVSMNTDDKGIVTVELAEGSYEVDVEKFGFSKVFELMQNDEILFVEPKKHWWH*
JGI20214J51088_1086657013300003432WetlandLEKIAHETINETQKVDEISQKTHVLIVKVLNFQKNKPTKNATVKVFRLEKEPLTLKQWAENLKNGSPFKRLIVSMNTDNNGTVSVELAEGSYEVEEEKFGFNKVFDLTQNDEILFIE
JGI20214J51650_1015974023300003541WetlandLEKIANETTIETQKVDEISQKTYLLVVKVVNFQKNKPTKNATVKVFRLEKEPLTLKQWAENLKNGSPFKRLIVSMNTDNNGTVTVELAEGSYEVEEEKFGFNKVFDLTQNDEILFIEPKKHWWH*
Ga0031655_1009973523300003852Freshwater Lake SedimentLDSVLEKNYNLVIQLVNYKKEPIKNVSVKIFKLEKESITLKQWAENLKNGLPFQRLILSINTDINGNLTAELVEGVYEIKVEKCSLSKVCELTQNDKVLFIDPKKRWWQ*
Ga0055451_1010189823300004004Natural And Restored WetlandsLASVLEKTLTLVVEMVHSQGKKPIQNVNVKIYRIEKEPITPQQWAENLKNGSSFKSLVLSMNTNDKGKVTAELPEGVYEAKVEKYGLTQFCDLKQNVKVIFVEPRKRWWQ*
Ga0055483_1028110813300004063Natural And Restored WetlandsKRQRVLMLLALDSVLEKTYKLIVRVVNFKENKPIKDVNVKVFRLEQEPITVKQWTENLKNGTPFKRLVLSMNTDNHDIITAELPEGVYEAKIEKYGLNKVFELTKNIEVLFVEPTKHWWSNT*
Ga0066599_10044744313300004282FreshwaterLEPQKVDVALEKTYLLVVSVVNFQTNKPIANVNVKVFRLEKTPLTISEWTENLKNGTPFSKLMLSMNTDNNGIVTAKLAEGSYEAKVEKYKKYNLSKVCELTQDDRIVFVEPKKHWWQ*
Ga0071344_102647123300005259Anaerobic Enrichment CultureVSNQKVNAVTEKTYVLVVKMVNFQKNKPTKNVNVKVFRLEKDPISPAQWADNLKNGSPFKRLIFSSETDNNGVVTAELTEGSYQVSVEKFGLDKAIEXWAFHTKPQFRLTT*
Ga0074471_1098628513300005831Sediment (Intertidal)MIVLELLLRKNSKLVVRVVDFKKKPIPNVLVRCFKIEKESITPEQWVANLKNGAPFKTLFFSINTDITGTVTAELPEGTYEVKVEAYGFNQVCELTQNVEVFVIEPKKHWWQG*
Ga0074469_1082846513300005832Sediment (Intertidal)LETGKVDVVLEKTYVLVARVVDFKRNEPIKDVNVKVFRLEKEPITLKQWTENLKNESPFKRLMLSMNTDNNGNVTAELVEGVYEVDVEKYGLSKVCELKQNDLVLFIEPKKHWWQQFYTRALKIGPC*
Ga0079037_10156732323300006224Freshwater WetlandsVGTQKVDEILEKSYVLVVKVVNFQKNKPTENANVKVFKLEKEPITLAQWTENLKNGTPFKRLILSATTTNSGTVTAELVKDFYEVEVEKFGSNKVCELTQNEEILFIEPKKHWWQ*
Ga0075521_1015358213300006642Arctic Peat SoilLESVLEKTYTLAVRAVNCKKQPSKNLNVTVSKLEKEPITLKQWAENLKNGTPFKRLVLSMNTDDDGNVNAELPEGVYEVKVEKYGLDEVCELKRNEEVVFVEPKKRW*
Ga0075524_1029740113300006950Arctic Peat SoilLDTQKVAVTLEKIYVIVVRVVNFQRNKPIKNVNVRVFRLEMEPITLKQWAENLKNGSPFEKLILSMNTDDNGNVSAELAEGSYEVKVEKYGLSKVCELTQNDTVFFIEPKKHWWQYS*
Ga0075524_1050690113300006950Arctic Peat SoilLDTQEVDVALEKTYVLVVGVVDFQRNKPIKNVNVKVFRLEMEPITLKQWAENLKNGTPFKKLILSMNTDNSGNVTAELAEGSYEVEVEKYNLSKVCELTQNDIVLFNETKKHWWQYS*
Ga0111545_100324053300007918SedimentLTKVDVIEKTYLLVVKMVDFQRNKPLKNVNVKVFRLETEPITPDQWAENLKNSAPFKRLILSANTDTTGVVTAELPEGTYEAKIQQYGLRKVCELTQNVEVLFTGPKKHWWQRP*
Ga0105105_1001427323300009009Freshwater SedimentVSTQKVDEILEKSYVLVVKVVNFQKNKPIKNVNVKVFRLEKEPITLAQWTENLKNGTPFKRLILSMNTANNGTVTAELAEGFYEVEVENFGFNKVCELTQNDEVLFIQPKKHWWQ*
Ga0105105_1030405413300009009Freshwater SedimentLYTQEVDTHTLEKTYVLVVRVVNFQKNEPIKDVNAKVFRLEKEPIPLNQWAENLKNGNPFKRLILSVNTDNNGNVTAELAEGVYEAKVEKYGLNKVFELTQNKEVLFIEPKKHWWWIKF*
Ga0066793_1067963413300009029Prmafrost SoilLDTQKVAIALEKTYMLVVSVVNFQTNKPITNVNVKVFRLEKTPITLSEWAENLKNGTPFKKLMLSMNTDNNGNATAELAEGSYEAKVEKYNLSKVCELT
Ga0066793_1071889013300009029Prmafrost SoilLDTQKVAVTLEKIYVIVVRVVNFQGDNPSKNVNVRVFRLEMEPITIKQWAENLKNGSPFEKLILSMNTDDNDNVSAELAEGSYEVEVEKYGLSKVCELTQNDTVLFIEPKKYWWQYS*
Ga0105093_1018041323300009037Freshwater SedimentVVKVVNFQKNKPIKNVNVKVFRLEKEPITLAQWTENLKNGTPFKRSILSMNTANNGTVTAELAEGFYEVEVENFGFNKVCELTQNDEVLFIQPKKHWWQ*
Ga0105093_1083103113300009037Freshwater SedimentCKSQNKKIQVFTLYTQEVDTHTLEKTYVLVVRVVNFQKNEPIKDVNAKVFRLEKEPITLNQWAENLKNGNPFKRLILSVNTDNNGNVTAELAEGVYEAKVEKYGLNKVFELTQNNEVLFIEPKEHWWWIKF*
Ga0105106_1010628233300009078Freshwater SedimentVSTQKVDEILEKSYVLVVKVVNFQKNKPIKNANVKVFRLEKEPITLAQWTENLKNGTPFKRSILSMNTANNGTVTAELAEGFYEVEVENFGFNKVCELTQNDEVLFIQPKKHWWQ*
Ga0105106_1109605023300009078Freshwater SedimentKNIQVFTLVTQEVDIHALEKTYVLVVRVVNFQKNEPIKDVNAEIFRLEKEPITLNQWAENLKNGNPFKRLILSVNTDNNGNVTAELAEGVYEAKVEKYGLNKVFELTQNKEVLFIEPKKHWWWIKF*
Ga0105103_1055357313300009085Freshwater SedimentLVTQEFDIHALEKTYVLVVRVVNFQRNEPIKDVNVKVFRLEKEPITLKQWAENLKNGTPFKRLILSVNTDNNGNVTAELAEGVYEAKVEKYGLNKV
Ga0115026_1000697253300009111WetlandVGTQKVDEILEKSYVLVVKVVNFQKNKPTENANVKVFKLEKEPITLAQWTENLKNGTPFKRLILSATTTNSGTVTAELVKDFYEVEVEKFGSNKVC
Ga0115026_1017165223300009111WetlandLVTQEVDVHALEETYVLVVRVVNFQRNEQIKDVNVKVFRLEKEPITLDQWAENLKNGTPFKRLILSVNTDNNGNVTAELAEGVYEAKVEKYGLNKVFELTQNNEVLFIEPKKHWWWIKF*
Ga0105091_1028543213300009146Freshwater SedimentSYTLVVNLVNFRGNKPIRDVNVKVFRLEKEPIKLEQWAENLRNGSPFKRLIFSTNTDNEGNVTAQLIEGSYEVNVEKYGLSKVCELKKNDQVLFIERERKRWWHLEF*
Ga0105094_1064234613300009153Freshwater SedimentVSTQKVDEILEKSYVLVVKVVNFQKNKPIKNANVKVFRLEKEPITLAQWTENLKNGTPFKRSILSMNTANNGTVTAELAEGFYEVEVENFGFNKVCELTQNDEVLFIKPKKHWWQ*
Ga0105102_1026658413300009165Freshwater SedimentLYTQEVDTHALEKTYVLVVRVVNFQKNEPIKDVNAKVFRLEKEPIPLNQWAENLKNGNPFKRLILSVNTDNKEKVTAELAEGVYEAKVEKYGLNKVFELTQNNEVLFIEPKKHWWWIKF*
Ga0113563_1260004713300009167Freshwater WetlandsKSYVLVVKVVNFQKNKPTENANVKVFKLEKEPITLAQWTENLKNGTPFKRLILSTTTTNSGTATAELVKGFYEVEVEKFGSNKVCELTQNEEILFIEPKKHWWQ*
Ga0105101_1006336533300009171Freshwater SedimentVSTQKVDEILEKSYVLVVKVVNFQKNKPIKNVNVKVFRLEKEPITLAQWTENLKNGTPFKRLILSMNTANNGTVTAELAEGFYEVEVENFGFNKVCELTQNDEVLFIQP
Ga0115028_1006997933300009179WetlandLVTQEFDIHALEQSYVLVVRVVNFQRNEQIKDVNVKVFRLEKEPITLDQWAENLKNGTPFKRLILSVNTDNNGNVTAELAEGVYEAKVEKYGLNKVFKLTQNNEVLFIEPKKHWWWIKF*
Ga0115028_1020487113300009179WetlandVGTQKVDEILEKSYVLVVKVVYFQKNKPTENANVKVFKLEKEPITLAQWTENLKNGTPFKRLILSATTTNSGTVTAELVKDFYEVEVEKFGSNKVCELTQNEEILFIEPKKHWWQLS*
Ga0114951_1000182693300009502FreshwaterLESILEKTYKLTIKVVNFKENQPINNVNVQVFRLEKEPITPKQWAENLKNGAPFKRLVLSMNTDDNGNVNAELPEGDYEVKVEKYGLSKVCQLKQNDSVLFVAPKEHWWQ*
Ga0116128_106099523300009518PeatlandLDTQEVAVALEKTYVIVVRVVNFQGNKPIKDVNVKVFRLEKTPITLKQWAENLKNGTPFKKLILSMNTDNNGNVTAELAEGSYEVKVEKYGLNKVCELTQNDSVLFIEPKKHWWQ*
Ga0116108_101303533300009519PeatlandLDTQEVAVALEKTYVIVVRVVNFQGNKPIKDVNVKVFRLEKTPITLKQWAENLKNGTPFKKLILSMNTDNNGNVTAELAEGSYEVKVEKYGLNKVCELTQNDRVLFIEPKKHWWQ*
Ga0116136_101221613300009547PeatlandLDTQEVAVPLEKTYVLVVSVVNFQRNEPIKDINVKVFRLEKEPITLKQWAEDLKNGTPFTKLILSMNTDNNGNVTAELAEGFYEAKVEKHGLNKPCELTQNNRALFIEPKKHWWQ*
Ga0116137_101770733300009549PeatlandALEKTYVIVVRVVNFQGNKPIKDVNVKVFRLEKTPITLKQWAENLKNGTPFKKLILSMNTDNNGNVTAELAEGSYEVKVEKYGLNKVCELTQNDRVLFIEPKKHWWQ*
Ga0116137_103402913300009549PeatlandLDTQEVAVALEKTYVLVVRVVNFQGNKPIKDVNVKVFRLETEPITLEQWAENLKNGTPFNRLMLSMNTDDNGNVTAELAEGSYEVKVEKYGLNKVCELTQNDSVLFIEPKKHWWQ*
Ga0116103_107584223300009615PeatlandVNFQGNKPIKDVNVKVFRLEKEPITLEQWAENLKNGTPFKRLMLSMNTDNNGNVTVELAEGSYEVKVEKYGLNKVCELTQNDSVLFIEPKKHWWQ*
Ga0116111_117335213300009616PeatlandLDTQEVAVALEKTYVLVVRVVSFQRNKPIKHVNVKVFRLEKALITLQQWAENLKNGAPFEKLILSMNTDNDGNVTAELAEGSYEVKVEKYGLNKSFELTQNDRVLFIEPKKALW
Ga0116119_100421913300009629PeatlandICKLQNKIIQGFTLDTQEVAVALEKTYVLVVRVVNFQGNKPIKDVNVKVFRLETEPITLEQWAENLKNGTPFNRLMLSMNTDDNGNVTAELAEGSYEVKVEKYGLNKVCELTQNDRVLFIEPKKHWWQ*
Ga0116115_118255213300009631PeatlandLDTQEVAVALEKTHVLVVRVVNFKRNKPIKNVNVKVFRLEKAPITLQQWAENLKNGASNERLILSMNTDNDGNVTAELAEGSYEVKVEKYSLNKSLELTQNERVLFIEPKKHWWQ*
Ga0116112_117339413300009636PeatlandLDTQEVAVALEKTYVIVVRVVNFQGNKPIKDVNVKVFRLEKTPITLKQWAENLKNGTPFKKLILSMNTDNNGNVTAELAEGSYEVKVEKYGLNKV
Ga0116122_119975313300009639PeatlandLDTQEVAVALEKTYVLVVRVVSFQRNKPIKNVNVQVFRLEKTAITLKQWAENLKNGAPFEKLVLSMNTDDNGNVTAELAEGSYEVKVEKYGLNKTFELTQNDRVLFIESKKHWWQ*
Ga0116126_122537423300009640PeatlandLDTQEVAVPLEKTYVLVVSVVNFQRNEPIKDINVKVFRLEKEPITLKQWAEDLKNGTPFTKLILSMNTDNNGNVTAELAEGFYEAKVEKHGLNKPCELTQNNSALFIEPKKHWWQ*
Ga0116132_107350113300009646PeatlandLDTQEVAVALEKTYVLVVRVVNFQGNKPIKDVNVKVFRLETEPITLEQWAENLKNGTPFNRLMLSMNTDDNGNVTAELAEGSYEVKVEKYGLNKVCELTQND
Ga0116134_122557713300009764PeatlandLDTPEVDVALEKTYVLVVRVVSFQRNKLIKNVNVKVFRLEKAPITLQQWAENLKNGAPFEKLILSMNTDNDGNVTAELAGGFYEVKVEKYGLNKTF
Ga0074045_1002277823300010341Bog Forest SoilLICIQKSQNKIIKGFTLDAPEVAVALEKTYMLVVRVVNFQRNKSIKNVNVKVFRLEKAPITLKQWAEYLKNGAPFEKLILSMNTDNDGNVTAALAEGSYEVKVEKYGLNKTFELTQNDRVLFIEPKKHWWQ*
Ga0074044_1016385223300010343Bog Forest SoilFQRNKSIKNVNVKVFRLEKAPITLKQWAEYLKNGAPFEKLILSMNTDNDGNVTAALAEGSYEVKVEKYGLNKTFELTQNDRVLFIEPKKHWWQ*
Ga0153915_1191027923300012931Freshwater WetlandsVVNFQGNQPIKNINVKVFRLEKAPITLKQWAENLKNGTPFKKLMLSTNTDDNGNATAELAEGSYEVEVEKNGLSKVCELTQNGFVLFVEPKKHWWDRS*
Ga0163199_139545013300013092FreshwaterIIQGFTLDTQKVAVALEKIYMIVVRVVNFQRNKPIKNVNVKVFRLEMEPITLKQWAENLKNGTPFKRLILSMNTDNDGNVTAELTEGVYEATVEKYGLNKVCELTQNDTVLFIEPKKHWWQYS*
Ga0181527_125635723300014153BogLDTQEVAVALEKTYMLVVRVVNFQRNKPVKNVNVKVFRLEKAPITLQQWAENLKNGAPFKKLVLSMNTDNDGNVTAELAEGSYEVKVEKYGLSKSFELTQDDRVLFIEPKKYWWQ*
Ga0181530_1060260813300014159BogQGNKPIKNVNVKVFRLEKAPITLQQWAENLKNGAPFKRLMLSMNTDNDGNVTAELAEDSYEAEVEKYGLNKVCELTQNNRVLFIEPKKHWWQ*
Ga0181538_1059224113300014162BogLDTQEIAVALEKTYVLVVRVVNFQRNKPIMNVNVKVFRLEKAPITLQQWTENLKNGASNERLILSMNTDNDGNVTAELAEGSYEVKVEKYSLNKSLELTQNERVLFIEPKKHWWQ*
Ga0181523_1061814713300014165BogLDTQEIAVALEKTYVLVVRVVNFQRNKPIMNVNVKVFKLEKAPITLQQWTENLKNGASNERLILSMNTDNDGNVTAELADGSYEVKVEKYSLNKTFELTQNERVLFIEPKKHWWQ*
Ga0075318_100440713300014256Natural And Restored WetlandsVSTQKVDEILEKSYVLVVKVVSFQKNKPIKNANVKVFRLEKEPITLAQWTENLKNGTPFKRSILSMNTANNGTVTAELAEGFYEVEVENFGFNKVCELTQNDEALFIQPKKHWWQ*
Ga0075318_112603313300014256Natural And Restored WetlandsLRLLELGSFLEKTHKLVVRVVHFKGNKPFPDVNVKVYRVEKGPLSPTQWVENLKNGTPFKTMIISMSTDNIGNVTAELPEGVYEVKVENFGLNQVCELTQNLEVLFIEPKKRWW*
Ga0075319_108181113300014257Natural And Restored WetlandsMIVLELLLRKNSKLVVRVVDFKKKPIPNVLVRGFKIEKESITPEQWVANLKNGAPFKTLLFSINTDITGTVTAELPKGTYEVKVEVYGFNQVCELTQNVEVFVIEPKKHWW*
Ga0182010_1026758823300014490FenMQKVDPVLEKTYVLVVRVVNFQRNKPIKNVNVKVFRLETEPITLQQWAENLKNGTPSKRLVLSMNTGNNGNVTAELEMGSYEVKVEKYGLNKVCELTVNDEVLFIEPKKHWWQ*
Ga0182010_1037874413300014490FenMLLKHLEKRSRVLMILETLEAEPVLEKTHMLVVRVVDFQKKKPLKNVTVQVFKLEKEPITLKQWGENLKNGTPFKRLMSSMNTDDDGNVTAELAEGDYEVKVEKYDLSKVCELKQNDSVLFAAPREHWWQ*
Ga0182014_1012903433300014491BogMQKVDPVLEKTYVLVVRVVNFQNKPIKDVNVKVFRLEKSPITLQQWAENLKNGAPSKRLVLWMNNDNNGNITAELAMGSYEVKVEKYGLNKVCELM*
Ga0182017_1069901613300014494FenVDTQRVDDVLEKTYMLIVRVVSFQKNKPIQSVNVKVFRLEKESITLKQWAENLKNGTPSKRLVLSMNTGNNGNVTAELEMGSYEVKVEKYGLNKVCELMQNDSVLFIESKKHWWQ*
Ga0182019_1015704123300014498FenVDTQRVDDVLEKTYMLIVRVVSFQKNKPIQSVNVKVFRLEKESITLKQWAENLKNGTPFNRLIVSMNTDNNGTITAELTAGVYEAKVEKYGLSKVCELTQNDEILFIEPKKHRWQ*
Ga0182019_1031144623300014498FenMLVKHLEKRPRVLMTLETLEAEPVLEKTHIFVVRVVDFQKKKPLKNVTVQVFKLEKEPITLKQWGENLKNGTPFKRLMFSMNTDDDGNVTAELAEGDYEVEVEKYGLSKVCELKQNNSVLFVAPREHWWQ*
Ga0182019_1131628313300014498FenMEKRRRVLMLLELEPVLEKTYTLVVRAVNYKKEPSKNLNVKVFRLEKEPITLNQWAENLRNGTPFKRLILSKDTDNNGNVTVELPEGVYEAKVEKYGLSKVCELKQNDEILLIEPQLHWWKS*
Ga0182021_10005689223300014502FenMLAVRLVNFQKNKPIANVKVEIFRLENEPISLKQWAENLKNGSPFKRLILSTNTDNNGNVTAELSEGLYEVKVEKFGLNKSCKLTQNDEVLCIESKKHWWQ*
Ga0182021_10011939123300014502FenMQKVDPVLEKTYVLVVRVVNFQNKPIKDVNVKVFRLEKAPITLQQWVENLKNGAPSKRLVLSMNTDNNGNVTAELAMGSYEVKVEKYGLNKVCELTVNDEVLFIEPKKHWWQ*
Ga0182021_1002506383300014502FenLENTHTFTVNVLNSKQNKPVKNVNVKLFRLEKESITLKQWTENLKNGTPFKRLMLSVDTDNNGNVTAEFPEGVYEAKVEEYGLSEVCELTHNVEILFAEPKKHWWKHS*
Ga0182021_1002888933300014502FenLETKVANNSLEKTHMLVVKVVNFQKNKPIKNVNIKVFRLEKEPITLKHWAANLKNGVPFKTLMLSMNTDNNGNATAELAEGFYEVKVEEYGLSQACELRQNDSFLFIEPKKHWWQ*
Ga0182021_1003559833300014502FenMLNIQKVAVALEKTHVIVVSVVNFQKNKPIKNVQVEVFRLEKEPITVSQWVENLRNGSPFKRLMLSTPTDNDGNVTAELAEGSYEVNVEIYGLTKVCELSQDERVLFIEPKKNWWQG*
Ga0182021_1004606163300014502FenLETKEVAVVLEKNYVLVVSVVNFQQNKPIKNVNVKVFRLEKEPITVEQWAENIKNGTSFKRLMLSMNTDNDGNVTAELAEGSYEVEVEIYGILKVCELTQNSKVLFIEPKKHWWR*
Ga0182021_1013833623300014502FenLESIIEIKHSFNVRVVESKENKPIKNVNVKVFRLETEPISLTQWGENLKTGTPFKCLILSINTDNMGNVTADLPEGTYEAKVEKYNLIEVCELKQNTEILFIEPKKKWWQ*
Ga0182021_1031148523300014502FenMQKVGPLLEKTYVLIVRVINFQNKLIKDVNVKVFRLEKAPITLQQWAENLKNGAPSKRLVLSMNTDNKGNVTAELAIGSYELKVEKYGLNKVCELMQNDSVLFIEPKKHWWQ*
Ga0182021_1044768313300014502FenLDSVLKETYTLIIQVVNYKKEPIKNVSVKIFKLEKESITLNQWAENLKNGAPFQRLILSMNTDINGNVTAELAEGVYELKVEKYGLSKVCELTQNDEVLFIEPKKHWWQ*
Ga0182021_1073258813300014502FenLDSVLEKNHLFTVRVVNNKKELIKNVNVQIWKIEKEPITLEQWGENLKNGTPFKRLILSSNTDNNGVVTADLVEGFYEAKVEKYGLSTVCELRQNDEVVFIEPKKRWW*
Ga0182021_1075630013300014502FenVESVLEKTYTLVVKVVDFQRNKPIQNVNVKVFRLEKESITLKQWAENLKNGTPFKRLMISMNTDNRGMVTVELPEGVYETKVEEYGFAKGCSLKQNDEVVCIGPKKQWWR*
Ga0182021_1086417113300014502FenLGFSRKHLKRRILPGIKQLERIAHETTIDSQKVAEISQKTHVLIVKVVNYQKNKPTKNATVKVFRLEKEPIALTQWAENLKNGSPFKRLIVSMNTDNNGKATVELTEGSYEVEVEKFGFNKSFELTQNDEALFVEPKTHWWH*
Ga0182021_1148621413300014502FenMSHLERLGLKSLKSTIRVQNKTIQGFTLDTQKVAIALEKTYVIVVRVVNFQGDKLIKNVNVKVFRLEKTPIALAEWAENLKNGTPFKKLMLSMNTDNSGNVTAELAEGSYEVEVEKYGLSKVCELTQNDTVLFIEPKKHWWQYS*
Ga0182030_1063743013300014838BogNEQRSLLKSISHNVFNMQKVDPVLEKTYVLVVRVVNFQNKPIKDVNVKVFRLEKSPITLQQWAENLKNGAPSKRLVLWMNNDNNGNITAELAMGSYEVKVEKYGLNKVCELM*
Ga0182027_1014478023300014839FenMQKVDPVLEKTYALVVRVVNFQNKPIKDVNVKVFRLEKEPITLQQWVENLKNGDSSKRLVLSMISDNKGNVTAELAMGFYEVKVEKYGLSKVCELTQDDSVLFIEPRKRWWQ*
Ga0182027_1025538523300014839FenMFNSLKSTSHIIKLFRVFTLDTQEVAVVLEKTYVLVVSVVNFQGNKPIKDVNVKVFRLETEPITPEQWVENLKNGAPFKRLMLSMNTDDNGNVTAELAEGFYEAEVEKYGLNKVCELTQNNRVLFIEPKKHWWQ*
Ga0187856_107456423300017925PeatlandLDTQEVAVALEKTYVLVVRVVSFQRNKPIKNVNVQVFRLEKTAITLKQWAENLKNGAPFEKLVLSMNTDDNGNVTAELAEGSYEVKVEKYGLNEVCELTQNNSVLFIEPKKH
Ga0187849_102629533300017929PeatlandLDTQEVAVALEKTYVIVVRVVNFQGNKPIKDVNVKVFRLEKTPITLKQWAENLKNGTPFKKLILSMNTDNNGNVTAELAEGSYEVKVEKYGLNKVCELTQNDRVLFIEPKKHWWQ
Ga0187849_103084733300017929PeatlandLDTQEVAVALEKTYVLVVRVVNFQGNKPIKDVNVKVFRLETEPITLEQWAENLKNGTPFNRLMLSMNTDDNGNVTAELAEGSYEVKVEKYGLNKVCELTQNDSVLFIEPKKHWWQ
Ga0187877_103340233300017931PeatlandLDTQEVAVALEKTYVIVVRVVNFQGNKPIKDVNVKVFRLEKTPITLKQWAENLKNGTPFKRLILSMNTDNNGNVTAELAEGSYEVKVEKYGLNKVCELTQNDRVLFIEPKKHWWQ
Ga0187848_1000058943300017935PeatlandLDTQEVAVPLEKTYVLVVSVVNFQRNEPIKDINVKVFRLEKEPITLKQWAEDLKNGTPFTKLILSMNTDNNGNVTAELAEGFYEAKVEKHGLNKPCELTQNNRALFIEPKKHWWQ
Ga0187853_1005400123300017940PeatlandLDTQEVAVALEKTYVLVVRVVNFQGNKPIKDVNVKVFRLETEPITLEQWAENLKNGTPFNRLMLSMNTDDNGNVTAELEEGSYEVKVEKYCLNKVCELTQNDSVLFIEPKKHWWQ
Ga0187780_1121603613300017973Tropical PeatlandLDTKEVAAALEKPYVLVVSVVNFQGSKPIGNVNVKVFRLETEPITLEQWAENLKNGTPFKRLMLSTNTDNDGYVTAELAEGSYEVKVEKYGLNKVCELTQNDRVLFIEPKKHWWQ
Ga0187891_104991923300017996PeatlandLDTQEVAVALEKTYVLVVRVFSFQRNKPIKNVNVQVFRLEKTAITLKQWAEDLKNGTPFTKLILSMNTDNNGNVTAELAEGFYEAKVEKHGLNKPCELTQNNRALFIEPKKHWWQ
Ga0187876_114238323300018003PeatlandMYKSQNKIVQGFVLDTQEVAVALEKTYVLVVRVVNFQGNIPIKNVNVKVFRLEKTPITLQQWAANLKNGAPFKKLIFSMNTDNDGNVTAELAEGSYEVKVEKYGLSKPFELTQDDRVLFIEPKKHWWQ
Ga0187876_115010523300018003PeatlandLDTQEVAVPLEKTYVLVVSVVNFQRNEPIKDINVKVFRLEKEPITLKQWAEDLKNGTPFTKLILSMNTDNNGNVTAELAEGFYEAKVEKHGLNKPCELT
Ga0187865_102542333300018004PeatlandALEKTYVIVVRVVNFQGNKPIKDVNVKVFRLEKTPITLKQWAENLKNGTPFKKLILSMNTDNNGNVTAELAEGSYEVKVEKYGLNKVCELTQNDRVLFIEPKKHWWQ
Ga0187884_1011249923300018009PeatlandLDTQEVAVALEKTYVLVVRVVNFQGNKPIKDVNVKVFRLEKAPITLQQWAENLKNGAPFKKLILSMNTDNDGNVTAELAEGSYEVKVEKYGLNKPFELTQNDRVLFIEPKKHWW
Ga0187880_127869213300018016PeatlandLDTKEVAVGLEKTYVLVVRVVNFQRNKPIMNVNVKVFRLEKTPITLQQWAANLKNGAPFKKLIFSMNTDNDGNVTAELAEGSYEVKVEKYGLSKPFKLTHNDRFLFFETKKHWWQ
Ga0187872_1028100113300018017PeatlandFTLDTQEVAVALEKTYMLVVSVVSFQSNKPIKNVNVKVFKLEKAPITLKQWAENLKNGAPFEKLVLSMNTDDNGNVTAELAEGSYEVKVEKYGLNEVCELTQNNSVLFIEPKKH
Ga0187874_10000907163300018019PeatlandLDTQGVAVALEKTYVLVVRVVNFQRNIPIKNVNVKVFRLEKAPIALQQWAENLKNGVPFKKLMLSMNTDNDGNVTAELAEGSYEVKVEKYGLINPFELTQNDRVLFIEPKKHWWQ
Ga0187874_10001184323300018019PeatlandLDPQEVAVALEKTYVLVVRVVNFQRNKPIKNVNVKVFILEKAPITLQQWAENLKNGAPFKKLILSMNTDNDGNVTAELAEGSYEVKVEKYGLNKPFELTQNDRVLFIEPKKHWWQ
Ga0187874_10001362143300018019PeatlandLDKQEVDIHALEKTYVLVVRVVNFQGNNPLENVNVKVFRLETEPITLKQWAENLKNGTPFNRLMLSMNTDNDGNVTAELTKGVYEAEVEKYGLDKVCELTQNDRVLFIEPKKHWWQ
Ga0187882_113204523300018021PeatlandLDTQEVAVALEKTYVLVVRVVNFQGNKPIKDVNVKVFRLETEPITLEQWAENLKNGTPFNRLMLSMNTDDNGNVTAELAEGSYEVKVEKYGLNKVCE
Ga0187869_1026901613300018030PeatlandSVSSSTKSSVHLKSLKSTSHRIKLFRVFALDTQEVAVALEKIYVLVVRVVNFQRNKPIKNVNVKVFRLEKAPITLQQWAENLKNGAPFKKLILSMNTDNDGNVTAELAEGSYEAEVEKYGLNKPFELTQNKRVLFIEPKKHWWQ
Ga0187867_1057010313300018033PeatlandLDTPEVAVALEKTYVLVVRVVNFQRNKPIMNVNVKVFRLEKAPITLQQWAENLKNGAPFEKLILSMNTDNDGNVTAELAEGFYEVKVEKYGLNKHFELTQNDKVLFIEPKKHWWQ
Ga0187784_1005792663300018062Tropical PeatlandLDTKEVAAALEKPYVLVVSVVNFQGSKPIGNVNVKVFRLETEPITLEQWAENLKNGTPFKRLMLSANTDNDGYVTAELAEGSYEVKVEKYGLNKVCELTQNDRVLFIEPKKHWWQ
Ga0187769_1005417013300018086Tropical PeatlandEIIQGFALDTQELDVHALEKTYVLVVSVVNFQGSKPIGNVNVKVFRLETEPITLEQWAENLKNGTPFKRLMLSTNTDNDGYVTAELAEGSYEVKVEKYGLNKVCELTQNDRVLFIEPKKHWWQ
Ga0212088_10003710303300022555Freshwater Lake HypolimnionLESILEKTYKLTIKVVNFKENQPINNVNVQVFRLEKEPITPKQWAENLKNGAPFKRLVLSMNTDDNGNVNAELPEGDYEVKVEKYGLSKVCQLKQNDSVLFVAPKEHWWQ
Ga0224520_113175823300023075SoilMQKVDPVLEKTYALVVRVVNFQNKPIKDVNVKVFRLEKAPITLQQWVENLKNGAPSKRLVLSMNTDNNGNVTAELAMGSYEVKVEKYGLNKVCELMQNDSVLFIESKKHWWQ
Ga0224521_105618513300024233SoilLVAQKVDNVCEKTYMLAVRLVNFQKNKPIANVKVEIFRLENEPISLKQWAENLKNGSPFKRLILSTNTDNNGNVTAELSEGLYEVKVEKFGLNKSCKLTQNDEVLC
Ga0209322_1032777223300025146SoilVGNQKADAILEKTYVLVIKVVNFQKNEPTKNANIKVFKLEKEPITPTQWAENLKNRSPFKRLILSMNTDNNGTVTAELTEGFYEVEVENFGIRVLELKRNDEVLFIEPKKYWWH
Ga0208373_123116913300025152SoilLEKIHSLVVRVVNQSNKPIPNVNVKVFRLEKESISPQQWAENLKNGAPFKTLVISMNTNNHGTVTAELPEGAYEAKVEGYGFNKVCELTQNADVLFIEPKKCWWQS
Ga0209083_1001444273300025162FreshwaterLEKTYKLTIKVVNFKENQPINNVNVQVFRLEKEPITPKQWAENLKNGAPFKRLVLSMNTDDNGNVNAELPEGDYEVKVEKYGLSKVCQLKQNDSVLFVAPKEHWWQ
Ga0209431_1036415023300025313SoilLEKIHTLIVRVVNQSNKPIPNVNVKIFRLEKESITPQQWAENLKNGAPFKTLVISINTNNNGTVTAELPEGAYEAKLEGYGFDKICELTQNADILFIEPKKRWWQS
Ga0208562_102026123300025460PeatlandLDTQEVAVALEKTYVIVVRVVNFQGNKPIKDVNVKVFRLEKTPITLKQWAENLKNGTPFKKLILSMNTDNNGNVTAELAEGSYEVKVEKYGLNKVCELTQNDSVLFIEPKKHWWQ
Ga0209746_107750933300025716Arctic Peat SoilLDTQEVDIALEKTYMLVVGVVDFQRNKPIKNVNVKVFRLEKAPITLKQYAENLKNGTPFKRLVLSMNTDDNGNVTAFLTEGAYEFAVEKYGLNKVCDLTQNDEVLFIEPKLHWWQ
Ga0209484_1004767523300025829Arctic Peat SoilLDTQKVAVTLEKIYVIVVRVVNFQRNKPIKNVNVRVFRLEMEPITLKQWAENLKNGSPFEKLILSMNTDDNGNVSAELAEGSYEVKVEKYGLSKVCELTQNDTVFFIEPKKHWWQYS
Ga0209538_132333713300025846Arctic Peat SoilVGTQNVDDVLEKTYMFVVRLVNFKENKTIKNVNVRVFRLEMEPITLKQWAENLKNGSPFEKLILSMNTDDNDNVSAELAEGSYEVEVEKYGLSKVCELTQNDTVLFIEPKKYWWQYS
Ga0209538_133145023300025846Arctic Peat SoilLDTQEVDVALEKTYVLVVGVVDFQRNKPIKNVNVKVFRLEKAPITLKQYAENLKNGTPFKRLVLSMNTDDNGNVSAELAEGSYEVEVEKYGLSKVL
Ga0209124_1019442013300025852Arctic Peat SoilLDTQEVDIALEKTYMLVVGVVDFQRNKPIKNVNVKVFRLEKAPITLKQYAENLKNGTPFKRLVLSMNTDDNGNVTAELAEGSYEAKVEKYNLSKVCELTQDDRILFIEPKKHWWQ
Ga0209429_1022372313300025864Arctic Peat SoilLDTQEVDVALEKTYVLVVGVVDFQRNKPIKNVNVKVFRLEKAPITLKQYAENLKNGTPFKRLVLSMNTDDNGNVTAELAEGSYEAEVEKYGLH
Ga0209226_1030905923300025865Arctic Peat SoilLDTQEVDVALEKTYVLVVGVVDFQRNKPIKNVNVKVFRLEKAPITLKQYAENLKNGTPFKRLVLSMNTDDNGNVTAELAEGSYEAEVEKYGLHKVCELT
Ga0209540_1003546553300025888Arctic Peat SoilLDSVLEKTYTLVLRVVNFQENKPIKNVNVKVFRLEKEPITVKQWAENLKSGNPFKMLILSMDTDNNGNVTAELTEGSYEVKVEKYGLNKVCELTQNDEVTFIEPKKHWWQ
Ga0209540_1058795713300025888Arctic Peat SoilLDTQEVDIALEKTYMLVVGVVDFQRNKPIKNVNVKVFRLEKAPITLKQYAENLKNGTPFKRLVLSMNTDDNGNVTAELAEGSYEAEVEKYGLHKVCELT
Ga0209540_1066156613300025888Arctic Peat SoilLDSILEKTYKIIVKVVDFKKNKPIKNVSVKVFRLEKEPITPKQWVENLKNGTPFKTLILSMNTDDNGNVTALLTEGAYEFAVEKYGLNKVCDLTQNDEVLFIEPKLHWWQ
Ga0209585_1007199633300025891Arctic Peat SoilLEKTYTLVLRVVIFQKNAPIKNVNVKVFRLETEPITPKQWAENLKNGTSFKRLILSMNTDNTGKVTAELPEGVYEAKVEKYGLSKVCELKQNDEVLFVEPKKHWWQ
Ga0256818_101425613300026353SedimentMLTKHLEKRKRVLILLKSVSEKTYALVIKVVNSKENYPIKNVNVKVFRIEKESITLAQWTENLKNGTPFKRLVLSANTDNNGVVTALLPEGVYETKLEKYNLSNVCELTKNAEVLFVEPKKRWWG
(restricted) Ga0255362_100817213300026366SoilLQLVAQKVDNVCEKTYMLAVRLVNFQKNKPIANVKVEIFRLENEPISLKQWAENLKNGSPFKRLILSTNTDNNGNVTAELSEGLYEVKVEKFGLNKSCKLTQNDEVLCIESKKHWWQ
Ga0209077_110237413300027675Freshwater SedimentLVVNLVNFRGNKPIRDVNVKVFRLEKEPIKLEQWAENLRNGSPFKRLIFSTNTDNEGNVTAQLIEGSYEVNVEKYGLSKVCELKKNDQVLFIERERKRWWHLEF
Ga0209703_109042913300027723Freshwater SedimentVSTQKVDEILEKSYVLVVKVVNFQKNKPIKNANVKVFRLEKEPITLAQWTENLKNGTPFKRSILSMNTANNGTVTAELAEGFYEVEVENFGFNKVCELTQNDEVLFIQPKKHWWQ
Ga0209288_1019243513300027762Freshwater SedimentVSTQKVDEILEKSYVLVVKVVNFQKNKPIKNVNVKVFRLEKEPITLAQWTENLKNGTPFKRLILSMNTANNGTVTAELAEGFYEVEVENFGFNKVCELTQNDEVLFIQPKKHWWQ
Ga0209293_1030019113300027877WetlandVGTQKVDEILEKSYVLVVKVVNFQKNKPTENANVKVFKLEKEPITLAQWTENLKNGTPFKRLILSATTTNSGTVTAELVKDFYEVEVEKFGSNKVCELTQNEEILFIEPKKHWWQ
Ga0209293_1035215623300027877WetlandLVTQEVDVHALEETYVLVVRVVNFQRNEQIKDVNVKVFRLEKEPITLDQWAENLKNGTPFKRLILSVNTDNNGNVTAELAEGVYEAKVEKYGLNKVF
Ga0208980_1074359723300027887WetlandSFHGNKPIANVNIKVFMLEKAPITLNQWAENLKNGTPFKKLVISMNTEENGNISTNLAEGSYEVEVEKYDLRKVCELTKDENVVFVAPKEHWWQ
Ga0209496_1044544013300027890WetlandNTQVFTLVTQEFDIHALEKTYVLVVRVVNFQRNEQIKDVNVKVFRLEKEPITLDQWAENLKNGTPFKRLILSVNTDNNGNVTAELAEGVYEAKVEKYGLNKVFELTQNSEVLFIEPKQHWWWIKF
Ga0209777_1016589713300027896Freshwater Lake SedimentLDSVLEKNYNLVIQLVNYKKEPIKNVSVKIFKLEKESITLKQWAENLKNGLPFQRLILSINTDINGNLTAELVEGVYEIKVEKCSLSKVCELTQNDKVLFIDPKKRWWQ
Ga0209254_1044997513300027897Freshwater Lake SedimentVVSVVNFQTNKPIKNVSVKVFRLEKTPLSISEWTENLKNGDPFSKLMLSMNTDNNGIVTAKLAEGSYEAKVEKYNLSKVCELTQDDRIVFVEPKKHWWQ
Ga0209668_1002803523300027899Freshwater Lake SedimentLEPQKVDVALEKTCLLAVSVVNFQANKPIANVNVKVFRLEKTPLTISEWTENLKNGTPFSKLMLSMNTDNNGIVTAKLAEGSYEAKVEKYNLSKVCELTQDDRIVLVEPKKHWWQ
Ga0209253_1080768423300027900Freshwater Lake SedimentLTIQEVDVHALEKTYVLVVRVVNFQRNEPIKDVNAKVFRLEKEPITLTQWSENLKNGTPFSKLMLSMNTDNNGFVTAKLAEGSYETKVEKYNLSKVCELTQDDKIVFVEPKKHWWQ
Ga0209048_1026721423300027902Freshwater Lake SedimentLDSVLEKTYALVLRVVNFQRNEPIKDVNAKVFRLEKEPITLDQWAENLKNGTPFKRLILSVNTDNNGNVTAELAEGVYEAKVEKYGLNKVFELTQNNEVLFIEPKKHWWWIKF
Ga0255359_12312723300028060SoilMQKVDPVLEKTYVLVVRVVNFQNKPIKDVNVKVFRLEKAPITLQQWVENLKNGAPSKRLVLSMNTDNNGNVTAELAMGSYEVKVEKYGLNKVCELTVNDEVLFIEPKKHWWQ
Ga0255358_104346713300028069SoilLKSISHNVFNMQKVDPVLEKTYVLVVRVVNFQNKPVKDVNVKVFRLEKEPITLQQWAENLKNGTPSKRLVLSMNTGNNGNVTAELEMGSYEVKVEKYGLNKVCELMQNDSVLFIESKKHWWQ
Ga0311332_1153710713300029984FenLESIIEIKHSFNVRVVESKENKPIKNVNVKVFRLETEPISLTQWGENLKTGTPFKCLILSINTDNMGNVTADLPEGTYEAKVENYNLIEVCELKQNTEILFIEPKKKWWQXSYP
Ga0311333_1199209613300030114FenHSFNVRVVESKENKPIKNVNVKVFRLETEPISLTQWGENLKTGTPFKCLILSINTDNMGNVTADLPEGTYEAKVEKYNLIEVCELKQNTEILFIEPKKKWWQ
Ga0265316_1032205823300031344RhizosphereLNSLLEKTHTFTVNVVNSKENKPVKNVNVKLFRLEKEAITLKQWTENLKNGTPFKRLMLSVDTDNNGSVTSELPEGVYEAKVEEYGLSEVCDLTHNVEIRFAEPKKRWWQHS
Ga0307446_109524313300031354Salt MarshMLLKLNSAVEKSYTLIIRVVNFKENKPIENVNVTVFRLEQESITLNQWTENLKNGTPFKRLIFSMNTDNNGMVTAEVSEGIYEAKIEKYGLTKICEITQNDEIVFVEPKKHWW
Ga0307440_108180513300031367Salt MarshMLLKMNSAVEKSYTLIIRVVNFKENKPIENVNVTVFRLEQESITLNQWTENLKNGTPFKRLIFSMNTDNNGMVTAEVSEGIYEAKIEKYGLTKICEITQNDEIVFVEPKKHWW
Ga0307379_1134789213300031565SoilLDTQKVDFGLEKTCLLVVNVVDFRSNKPIPNVNIKVIRLEKTPITLAEWTENLKSGNSFKKLMLSMNTDNSGSVTGKFAEGSYEAKVEKYNLSKVCELLHDDRILFMEPKKHWWQ
Ga0307377_1061159313300031673SoilTIQVFILDTQKVDFGLEKTCLLVVNVVDFRSNKPIPNVNIKVIRLEKTPITLAEWTENLKSGNSFKKLMLSMNTDNSGSVTGKFAEGSYEAKVEKYNLSKVCELLHDDRILFMEPKKHWW
Ga0316605_1169840013300033408SoilLDTQIAVHALEKTYVLIVKVVNFQKNKPIKNVNVKVFKLEKEPITLKQWAENLKNGTPFKKLMLSINTDDNGTVTAELAEGFYEVKVEEYGLGKTCELAQNDSVLFIEPKKHWWQ
Ga0316603_1141409513300033413SoilLVTQEVDVHALEETYVLVVRVVNFQRNEPIKDVNAKVFRLEKEPITLKQWAENLKNGTPFKRLILSVNTDNNGNVTAELAEGVYEAKVEKYGLNKVFELTQNNEVLFIEPKKHWWWIKF
Ga0316601_10020619233300033419SoilLDTQIAVHALEKTYVLIVKVVNFQKNKPIKNVNVKVFKLEKEPITLKQWAENLKNGTPFKKLMLSINTDDNGTVTAELAEGFYEVKVEEYGLGKTCELAQNDSVLFIEPKKRWWQQL
Ga0316601_10140995113300033419SoilLVTQEFDIHALEKTYVLVVRVVNFQRNEQIKDVNVKVFRLEKEPITLDQWAENLKNGTPFKRLILSVNTDNNGNVTAELSEGVYEVKVEKYGLNKVFELTQNNEVLFIEPKKHWWWIKF
Ga0316601_10228374913300033419SoilNFHKDKPIINVNVKVFRLEKEPITLAQWTENLKNGSPFKRLMLSMNTDNNGTVTAELAEGSYEAVVEKFGFNMVLELTHNDEVLFIEPKKHWWQ
Ga0326726_1095619323300033433Peat SoilLDTQKVDGPLEKTYTLVASVVSLQTNKPIRNVNVKFFRLEKTPITLTEWTENLKNGTPFKKLMLSMNTDNDGNVTAQLAEGSYEAKVEKYNLSKVCELTHDDRILFVEPKTHWWQ
Ga0316624_1019677713300033486SoilMLLELDSVLDKTYTLVVRMVNFKENEPIKNVNVKVFRLEQASITLKQWTENLKNGTPFKRLVLSMSTDNNGAVTAELSEGVYEVKVEKYGLNKSCKLTQKDEVLFVESKKHWWQ
Ga0316624_1026097323300033486SoilMGMVNLSILFRSFKFTRTQLNYSQVFTVSNQKVDQVLEKTYTLVVRVVSFKKIPLENVNVKIFRLEKEGISLKQWGENLKNGSPFKRLILSSTTNNNGNLSAELPAGVYEAQIEQYGLNNVSDLTQNAEILFVEPKKHWW
Ga0316630_1167037513300033487SoilVGTQKVDKILEKSHVLVIKVVNFHKNKPIINVNVKVFRLEKEPITLAQWTENLKNGSPFKRLMLSVNTDNNGTVTAELAEGSYEAVVEKFGFNRVFELTQK
Ga0316616_10074875423300033521SoilVGTQKVDKILEKSYVLVIKVVNFQKNKPIINVNVKVFRLEKEPITLAQWTENLKNGSPFKRLMLSLNTNNNGTVTAELAEGSYEAVVEKFGFNMVLELTQNDEVLFIEPKKHWWQ
Ga0316617_10263632713300033557SoilLVTQEVDVHASEKTYVLVVRVVNFQRNEPIKDVNAKVFRLEKEPITPKQWAENLKNGTPFKRLILSVNTDNNGNVTAELAEGVYEAKVEKYGLNKVFKLTQNNEVLFIEPKKHWWWIKF
Ga0334843_051305_124_5133300033825SoilMLSKHLEKRKRVLMLLGLDSVSEKTCRLVVRVVNFKGNEPITKVNVKVFRLEKEAISPQQWAENLKNGAPFKRLILSADSDNKGTVTAELPEGDYEAKVEKYGLSEIRKVTENAEVVFVEPKKHWWSNT
Ga0314861_0172846_361_7113300033977PeatlandLDTQEVDVYALEKTYVLVVRVVNFQRSKPIENVNVKVFRLETEPITLEQWAENLKNGTPFKRLMLSMNTDNNGNVTAELAEGSYEVKVEKYCLNKVCELTQNDRVLFIEPKKHWWQ
Ga0370490_0093034_3_2843300034128Untreated Peat SoilVETQKADQVLEKTYIFVVKVVNFKKDKPVKNVNVKIFRLEKEPITLNQWAENLKNGTPFKRLIISMNTDDDGQVSAEFTEGVYEAKVEQYSLSK
Ga0370490_0304083_2_3493300034128Untreated Peat SoilEVDIHALEKRYVLVVRVVNFQRNEPIKDVNVKVFRLENEPITLDQWAENLKNGTPFKRLILSVNTDNNGNVTAELAEGVYEAKVEKYGLNKVFELTQNNEVLFIEPKKHWWWIKF
Ga0370480_0289860_95_4363300034169Untreated Peat SoilVTTQKIEVLEETYKLVVRAVNFKKDKPIQNVNIKVFRLEKAPITLEQWAENLRNSSPFRRLMLSRNTDDNGYVTAELPEGSYEIQAEKNSLRVCELKQNEEVVFVEPKKHWWQ
Ga0370501_0200526_3_2813300034195Untreated Peat SoilLESIIERKHSFNVRVVESKENKPIKNVNVKVFRLETEPISLTQWGENLKTGTPFKCLILSINTDNMGNVTADLPEGTYEAKVEKYNLIEVCEL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.