NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F033159

Metagenome / Metatranscriptome Family F033159

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033159
Family Type Metagenome / Metatranscriptome
Number of Sequences 178
Average Sequence Length 44 residues
Representative Sequence VRLAVVDHGHAPDEAAFLQEIRERSGREPLGVVKTLLYRPELFG
Number of Associated Samples 154
Number of Associated Scaffolds 178

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 83.15 %
% of genes near scaffold ends (potentially truncated) 98.88 %
% of genes from short scaffolds (< 2000 bps) 91.57 %
Associated GOLD sequencing projects 147
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.258 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.112 % of family members)
Environment Ontology (ENVO) Unclassified
(28.652 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.382 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.67%    β-sheet: 0.00%    Coil/Unstructured: 58.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 178 Family Scaffolds
PF03471CorC_HlyC 14.04
PF03928HbpS-like 2.81
PF08544GHMP_kinases_C 2.25
PF01872RibD_C 2.25
PF07730HisKA_3 2.25
PF00565SNase 2.25
PF03734YkuD 2.25
PF01321Creatinase_N 1.69
PF10509GalKase_gal_bdg 1.69
PF02423OCD_Mu_crystall 1.12
PF00248Aldo_ket_red 1.12
PF00206Lyase_1 0.56
PF01152Bac_globin 0.56
PF01794Ferric_reduct 0.56
PF00140Sigma70_r1_2 0.56
PF04055Radical_SAM 0.56
PF00578AhpC-TSA 0.56
PF00890FAD_binding_2 0.56
PF00005ABC_tran 0.56
PF00067p450 0.56
PF12900Pyridox_ox_2 0.56
PF13463HTH_27 0.56
PF07831PYNP_C 0.56
PF06304DUF1048 0.56
PF03706LPG_synthase_TM 0.56
PF13229Beta_helix 0.56
PF05638T6SS_HCP 0.56
PF01022HTH_5 0.56
PF00246Peptidase_M14 0.56
PF01625PMSR 0.56
PF09851SHOCT 0.56
PF11946DUF3463 0.56
PF00258Flavodoxin_1 0.56
PF02894GFO_IDH_MocA_C 0.56
PF06662C5-epim_C 0.56
PF00126HTH_1 0.56
PF104171-cysPrx_C 0.56
PF00226DnaJ 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 178 Family Scaffolds
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 2.25
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 2.25
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 2.25
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 2.25
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 2.25
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 2.25
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 2.25
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 2.25
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 1.69
COG2423Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin familyAmino acid transport and metabolism [E] 1.12
COG0213Thymidine phosphorylaseNucleotide transport and metabolism [F] 0.56
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 0.56
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.56
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.56
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 0.56
COG2124Cytochrome P450Defense mechanisms [V] 0.56
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.56
COG3157Type VI protein secretion system component Hcp (secreted cytotoxin)Intracellular trafficking, secretion, and vesicular transport [U] 0.56
COG4817DNA-binding ferritin-like protein (Dps family)Replication, recombination and repair [L] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.26 %
UnclassifiedrootN/A6.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig78255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria832Open in IMG/M
2170459006|GBPF9FW02HYLX2All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
2170459007|GJE5RH003GQSI2All Organisms → cellular organisms → Bacteria506Open in IMG/M
2170459013|GO6OHWN01ANCH3All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
2170459015|G14TP7Y02I1XUPAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales626Open in IMG/M
2170459023|GZGNO2B01EDK8NAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
2189573000|GPBTN7E01B7E3FAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales516Open in IMG/M
3300000956|JGI10216J12902_100064304All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300001532|A20PFW1_1316810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1433Open in IMG/M
3300001534|A15PFW1_10331675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1351Open in IMG/M
3300001536|A1565W1_12097393All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300001978|JGI24747J21853_1041124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300004153|Ga0063455_100706258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis decaplanina680Open in IMG/M
3300004153|Ga0063455_101554127Not Available519Open in IMG/M
3300004156|Ga0062589_102551926All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300004157|Ga0062590_101161987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales749Open in IMG/M
3300005093|Ga0062594_102958513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae530Open in IMG/M
3300005176|Ga0066679_10446387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales847Open in IMG/M
3300005179|Ga0066684_10229577All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300005332|Ga0066388_100111103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3236Open in IMG/M
3300005332|Ga0066388_100138588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2992Open in IMG/M
3300005332|Ga0066388_102457221All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300005365|Ga0070688_101436457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300005365|Ga0070688_101561881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300005366|Ga0070659_100246781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1479Open in IMG/M
3300005434|Ga0070709_10556422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia878Open in IMG/M
3300005435|Ga0070714_101141742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria760Open in IMG/M
3300005440|Ga0070705_101757038All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005447|Ga0066689_10498675All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300005526|Ga0073909_10208429All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300005529|Ga0070741_11173875All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300005530|Ga0070679_101581682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia603Open in IMG/M
3300005535|Ga0070684_101516218All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300005545|Ga0070695_101775207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300005546|Ga0070696_100183171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1555Open in IMG/M
3300005563|Ga0068855_100493312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1332Open in IMG/M
3300005587|Ga0066654_10703467All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005607|Ga0070740_10152213All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300005719|Ga0068861_102285953Not Available542Open in IMG/M
3300005840|Ga0068870_10343408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales956Open in IMG/M
3300006028|Ga0070717_11466827All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300006031|Ga0066651_10717692All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300006032|Ga0066696_10513426All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300006175|Ga0070712_100015169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4956Open in IMG/M
3300006175|Ga0070712_100558532All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300006175|Ga0070712_101725818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300006354|Ga0075021_10439971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae821Open in IMG/M
3300006604|Ga0074060_11183642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales507Open in IMG/M
3300006854|Ga0075425_100192868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2341Open in IMG/M
3300006854|Ga0075425_101144941All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300006881|Ga0068865_100055959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2747Open in IMG/M
3300007821|Ga0104323_121170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1609Open in IMG/M
3300009093|Ga0105240_11399086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria735Open in IMG/M
3300009176|Ga0105242_10016226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5788Open in IMG/M
3300010039|Ga0126309_10923151Not Available580Open in IMG/M
3300010043|Ga0126380_10993329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria706Open in IMG/M
3300010227|Ga0136219_1010825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium901Open in IMG/M
3300010375|Ga0105239_12127514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium652Open in IMG/M
3300010398|Ga0126383_10110526All Organisms → cellular organisms → Bacteria2479Open in IMG/M
3300010400|Ga0134122_11989187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300010400|Ga0134122_13365026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300010403|Ga0134123_11134321All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300010880|Ga0126350_10925323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300010880|Ga0126350_12119983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300011119|Ga0105246_10108479All Organisms → cellular organisms → Bacteria → Terrabacteria group2035Open in IMG/M
3300011119|Ga0105246_10753638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium859Open in IMG/M
3300012096|Ga0137389_10095187All Organisms → cellular organisms → Bacteria2356Open in IMG/M
3300012198|Ga0137364_11158094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300012199|Ga0137383_10731657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae722Open in IMG/M
3300012204|Ga0137374_10932373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300012208|Ga0137376_10216913All Organisms → cellular organisms → Bacteria1657Open in IMG/M
3300012209|Ga0137379_10547036All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1065Open in IMG/M
3300012209|Ga0137379_11181607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria671Open in IMG/M
3300012209|Ga0137379_11241844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria652Open in IMG/M
3300012356|Ga0137371_11166729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300012362|Ga0137361_10734863All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium900Open in IMG/M
3300012469|Ga0150984_100513023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1144Open in IMG/M
3300012469|Ga0150984_118609146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1470Open in IMG/M
3300012911|Ga0157301_10231695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300012912|Ga0157306_10123291Not Available783Open in IMG/M
3300012955|Ga0164298_10869763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria652Open in IMG/M
3300012957|Ga0164303_10178863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1153Open in IMG/M
3300012958|Ga0164299_11480258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300012985|Ga0164308_10173852All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. PtaB.Bin1381616Open in IMG/M
3300012985|Ga0164308_10597968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria938Open in IMG/M
3300012986|Ga0164304_10297143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1105Open in IMG/M
3300012988|Ga0164306_10740085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria786Open in IMG/M
3300012989|Ga0164305_10929716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium733Open in IMG/M
3300012989|Ga0164305_11858408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300013296|Ga0157374_11511479All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300013296|Ga0157374_12083535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300013765|Ga0120172_1081583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi798Open in IMG/M
3300015077|Ga0173483_10031728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1930Open in IMG/M
3300015201|Ga0173478_10385283All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300015371|Ga0132258_10646341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2660Open in IMG/M
3300015374|Ga0132255_102022518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium877Open in IMG/M
3300016371|Ga0182034_10520851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria994Open in IMG/M
3300017792|Ga0163161_10206842All Organisms → cellular organisms → Bacteria1514Open in IMG/M
3300017792|Ga0163161_10732086All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300017944|Ga0187786_10007083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2644Open in IMG/M
3300017947|Ga0187785_10334356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300017959|Ga0187779_10588701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria744Open in IMG/M
3300017961|Ga0187778_10613641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria730Open in IMG/M
3300017966|Ga0187776_11335210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300017974|Ga0187777_10321115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium pusense1061Open in IMG/M
3300018060|Ga0187765_10116209All Organisms → cellular organisms → Bacteria1476Open in IMG/M
3300018060|Ga0187765_10943803All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300018064|Ga0187773_10117503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1333Open in IMG/M
3300018089|Ga0187774_10810951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300018431|Ga0066655_11203581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300018433|Ga0066667_10313514All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300018433|Ga0066667_11858054Not Available547Open in IMG/M
3300018433|Ga0066667_12115752Not Available521Open in IMG/M
3300018482|Ga0066669_11159250All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300020080|Ga0206350_10011582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300020081|Ga0206354_10840194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300021344|Ga0193719_10042375All Organisms → cellular organisms → Bacteria1972Open in IMG/M
3300022756|Ga0222622_10736201All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300022915|Ga0247790_10088307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium753Open in IMG/M
3300023097|Ga0247757_10322778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300023266|Ga0247789_1062585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300023275|Ga0247776_10259141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300024290|Ga0247667_1015947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1482Open in IMG/M
3300025913|Ga0207695_11228339Not Available630Open in IMG/M
3300025914|Ga0207671_10184890Not Available1623Open in IMG/M
3300025914|Ga0207671_10575287All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300025915|Ga0207693_11157827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300025921|Ga0207652_11768072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300025922|Ga0207646_11221028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300025924|Ga0207694_10695369All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300025926|Ga0207659_10063671All Organisms → cellular organisms → Bacteria2667Open in IMG/M
3300025931|Ga0207644_11093140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium670Open in IMG/M
3300025935|Ga0207709_11740067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300025938|Ga0207704_11710339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300025939|Ga0207665_10852079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium721Open in IMG/M
3300025939|Ga0207665_11427414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300026023|Ga0207677_11724357All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300026067|Ga0207678_11381815All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300026078|Ga0207702_11006934All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300026078|Ga0207702_11764044All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300026116|Ga0207674_10367354All Organisms → cellular organisms → Bacteria1391Open in IMG/M
3300026142|Ga0207698_12301301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300027706|Ga0209581_1274764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300027821|Ga0209811_10138205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria897Open in IMG/M
3300028556|Ga0265337_1136297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M
3300028573|Ga0265334_10182446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300028587|Ga0247828_10785009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300028799|Ga0307284_10086020All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300029957|Ga0265324_10221060Not Available643Open in IMG/M
3300031170|Ga0307498_10438945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300031229|Ga0299913_11936465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300031251|Ga0265327_10154253All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300031716|Ga0310813_11866120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium565Open in IMG/M
3300031726|Ga0302321_100817831Not Available1052Open in IMG/M
3300031740|Ga0307468_101212071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium681Open in IMG/M
3300031819|Ga0318568_10693347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300031847|Ga0310907_10876006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300031903|Ga0307407_10028375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2991Open in IMG/M
3300031908|Ga0310900_11322896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300031942|Ga0310916_10767965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria813Open in IMG/M
3300032008|Ga0318562_10504033All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300032008|Ga0318562_10664799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300032017|Ga0310899_10441355All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300032039|Ga0318559_10291363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300032063|Ga0318504_10341495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria711Open in IMG/M
3300032074|Ga0308173_11426268All Organisms → cellular organisms → Bacteria → Terrabacteria group650Open in IMG/M
3300032133|Ga0316583_10276247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300032180|Ga0307471_104192116Not Available509Open in IMG/M
3300032205|Ga0307472_102223609All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300032342|Ga0315286_11603015Not Available619Open in IMG/M
3300032770|Ga0335085_10023598All Organisms → cellular organisms → Bacteria8703Open in IMG/M
3300032892|Ga0335081_10523632All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300032893|Ga0335069_10430977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1541Open in IMG/M
3300032898|Ga0335072_10062535All Organisms → cellular organisms → Bacteria4935Open in IMG/M
3300033290|Ga0318519_10636358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300034090|Ga0326723_0326408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300034195|Ga0370501_0233653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300034820|Ga0373959_0205506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.11%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.74%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.62%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.37%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.25%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil2.25%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.25%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.25%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.69%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.69%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.12%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.12%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.12%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.12%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.12%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.12%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.12%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.12%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.12%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.12%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.12%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.12%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.12%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.56%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.56%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.56%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.56%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.56%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.56%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.56%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.56%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.56%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.56%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.56%
SoilEngineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2170459006Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cmEnvironmentalOpen in IMG/M
2170459007Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cmEnvironmentalOpen in IMG/M
2170459013Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cmEnvironmentalOpen in IMG/M
2170459015Litter degradation PV4EngineeredOpen in IMG/M
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001532Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-PF 12A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001534Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001978Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6Host-AssociatedOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005607Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007821Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010227Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 2EngineeredOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023097Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L126-311R-4EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300023275Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028573Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaGHost-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300029957Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaGHost-AssociatedOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032133Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrAHost-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_006112502140918007SoilMRLTVVDSGHAPDEAAMLDQIRERTGREPLGVVKTLLYRPELFGLP
L01_067690602170459006Grass SoilVRLEIVDHGHAPDEAAFLQEIRERSGREPLGVVKTLLYRPELFGLPFSDEL
L02_001672902170459007Grass SoilLRLAVVDSGHGPNEAAALDQIRQRSGREPLGVVKTLM
N57_056634002170459013Grass SoilMRLAVVDQGHAPQEAAVLAAIREQSGVEPLGVVKTLLYRPELFGEP
4PV_043612902170459015Switchgrass, Maize And Mischanthus LitterMRLSVVDSGHAPEQAAVLDVIRERSGNEPLGVVKPLMYRPELF
FA3_019990802170459023Grass SoilMRLAIVDEGHAPPEAAMLAAIRERTGAEPLGVVKT
N55_040276602189573000Grass SoilMIRLSVVDAGHTGDEAEFLRLARERGGREPLGVVKTLL
JGI10216J12902_10006430433300000956SoilMRLAVVDHAHGPVEAALLEEIRERSGREPLGVVKTILYRPELFG
A20PFW1_131681013300001532PermafrostVRLSVVDSGHQPGEAAMLAAIRERSGAEPLGVVKTLLYR
A15PFW1_1033167533300001534PermafrostVRLAVVDHGHAPAEAAILQEIRERMGAEPLGVVKTLMYRPELF
A1565W1_1209739333300001536PermafrostVRLATVDRGHAPDEAAMLAEIAERSGREPLGVVKTLLYRPE
JGI24747J21853_104112433300001978Corn, Switchgrass And Miscanthus RhizosphereMIRLSVVDHGHAPDQAAFLQQARERSGREPFGVVKTLVYRPEIFGGP
Ga0063455_10070625813300004153SoilVNVRLACIDHGHAPEQAAMLAEIRERSGREPLGVVKTLLYRPEVFGGPFSEELDDVMR
Ga0063455_10155412723300004153SoilMRLSVVDGGHAPAEAAMLEAIGQRSGAEPLGVVKTLLYRP
Ga0062589_10255192623300004156SoilMRLSVVDSGHAPEQAAVLDVIRERSGNEPLGVVKTLMYRPELFGR
Ga0062590_10116198733300004157SoilVRLAVVDHGHAPPEAAMLEAIGQRTGTEPLGVVKTLLYRP
Ga0062594_10295851313300005093SoilVRLAVVDHGHRPDEAAVLDVIRERSGNEPLGVVKTLLYRP
Ga0066679_1044638713300005176SoilMRLTVVDTGHAPAEAEVLGQIRERTGREPLGVVKTLLYRPDLFG
Ga0066684_1022957733300005179SoilMRLAVVDAGHAPPEAAMLATIRERTGNEPLGVIKTLLYRPELFG
Ga0066388_10011110343300005332Tropical Forest SoilMRLAVLDEGHAAPEAEMLAAIRERTANEPLGVVKTLLYRPELFGEPFSEAL
Ga0066388_10013858813300005332Tropical Forest SoilMRLGVVDAGHAPPEAAMLAAIREQSGAEPLGVIKTLLYRPELFGEPFSE
Ga0066388_10245722113300005332Tropical Forest SoilMRLEVVDTGHAPPEAAMLAAIREQSGVEPLGVIKTLLYRPELF
Ga0070688_10143645713300005365Switchgrass RhizosphereVRLSVVDSGHAPAEVAVLEAIRERSGHEPLGVVKTLLYRPE
Ga0070688_10156188123300005365Switchgrass RhizosphereMRLSVVDNGHAPERAAVLATIRERSGHEPLGVVKTLMYRP
Ga0070659_10024678113300005366Corn RhizosphereMRLAVVDSGHLPAEAAVLAEVRERSGAEPLGVVKTLYYRPELFGR
Ga0070709_1055642233300005434Corn, Switchgrass And Miscanthus RhizosphereMMRLSVVDHGHEPDAAAFLQQVRERSGREPLGVVKTLVYRPELFGGPFSEELDV
Ga0070714_10114174213300005435Agricultural SoilLRLAVVDHGHAPAEAALLAAIQERTGTEPLGVVKTLLYRPEL
Ga0070705_10175703823300005440Corn, Switchgrass And Miscanthus RhizosphereMRLAVVDCGHAAPEAEMLRMIRERSATEPLGVVKTLLYRPELFGEPFSDAL
Ga0066689_1049867513300005447SoilMRLAIVDEGHAPPEAAMLAAIREGTGAEPLGVIKTLLYRPELFGEPFSEAL
Ga0073909_1020842913300005526Surface SoilMIRLECIDRGHAPDEAAMLAEIRERSGAEPLGVVKT
Ga0070741_1117387513300005529Surface SoilMRLAVVDRGHAAGEAAVLETIRERSGNEPLGVVKTLLYRPEEFGRPFS
Ga0070679_10158168233300005530Corn RhizosphereVRLAVVDSGHQQEEAAMLAAIRERSGAEPPGVVKTLLYRPELFG
Ga0070684_10151621813300005535Corn RhizosphereMRLAVVDSGHAPVQAAMLDVIRERTGNEPLGVVKTLLYRPELFGLPFSEAL
Ga0070695_10177520713300005545Corn, Switchgrass And Miscanthus RhizosphereMRLALVDTGHAPGEAAVLDQIRERTGREPLGVVKTLLYRPELFGLPFS
Ga0070696_10018317113300005546Corn, Switchgrass And Miscanthus RhizosphereMIRLSVVDHGHAPDQAAFLQQARERSGREPFGVVKTLVYRPEIFGGPFTGELH
Ga0068855_10049331233300005563Corn RhizosphereMRLAVVDHGHAPDAAAVLAEIRERSGAEPLDVVKTLLYRPEL
Ga0066654_1070346713300005587SoilMRIAVVDEGHALPEAEMLAAIRERTGAEPLGVVKTLLYRPELFGEPF
Ga0070740_1015221313300005607Surface SoilMRLAVVDGNHAPAEAALLEQIRERSGVEPLGVVKTLLYRPELFGRPFSDALE
Ga0068861_10228595313300005719Switchgrass RhizosphereVRLSVVDSGHAPEHAAMLDVIRERSGNEPLGVVKT
Ga0068870_1034340833300005840Miscanthus RhizosphereMRLSVVDKGHAPEQAAVLATIRERSGHEPLGVVKTLMYRPELF
Ga0070717_1146682713300006028Corn, Switchgrass And Miscanthus RhizosphereVRLAVVDHGHAPDEAAFLQEIRERSGREPLGVVKTLLYRPELFG
Ga0066651_1071769213300006031SoilMRLAVVDQGHAPQEAAMLATIREQSRAEPLGVVKTLLYRPELFG
Ga0066696_1051342613300006032SoilMRLAVVDQGHAPQEAAMLATIREQSRAEPLGVVKTLLYRP
Ga0070712_10001516913300006175Corn, Switchgrass And Miscanthus RhizosphereMIRLECIDRGHAPDEAAMLAEIRERSGAEPLGVVKTLLYRPELFG
Ga0070712_10055853233300006175Corn, Switchgrass And Miscanthus RhizosphereMRLGVVDAGHAPAEAAVLDEIRERTGREPLGVVKTLLYRPELFG
Ga0070712_10172581813300006175Corn, Switchgrass And Miscanthus RhizosphereVRLAVVDSGHEPEAAEMLDAIRERSGAEPLAVVKTLL
Ga0075021_1043997113300006354WatershedsVRLQVVDHGHAPEEAAALQEIRERMGAEPLGVIKTLMYRPELFGRPFSD
Ga0074060_1118364233300006604SoilVIRLSVVDRGHAPAQAAFLEQARQRSGREPFGVVKTLVYRPEIFGAPFTREL
Ga0075425_10019286813300006854Populus RhizosphereMRLGVVDGGHAAAEAQMLTMIRERSGTEPLGVVKTLLYR
Ga0075425_10114494133300006854Populus RhizosphereMRLSVVGDGHAPAEAAMLGEIRSRSGHEPLGVVKTLLYRPELFG
Ga0068865_10005595913300006881Miscanthus RhizosphereVRLSVVDSGHAPEHAAVLDVIRERSGNEPLGVVKTLLYR
Ga0104323_12117043300007821SoilVRLSVVDSGHQPDEAAMLDAIRERSGAEPLGVVKTLLYRPELFGTPFSE
Ga0105240_1139908633300009093Corn RhizosphereLRLAVVDNGHGPNEAAALDQIRERSGREPLGVVKTLMYRPELFGLPFSDVLAT
Ga0105242_10016226133300009176Miscanthus RhizosphereVRLQVVDQGHRPEEAAVLDMIRQRSGREPLGVVKTLLYRPELFGTPFSEALDDV
Ga0126309_1092315113300010039Serpentine SoilMRLSVVDSGHEATEAAVLDAIRERSGAEPLGVVKTIH
Ga0126380_1099332913300010043Tropical Forest SoilVRLAIVDEGHAPPEAAMLAAIREQSGAEPLGVIKTLLYRPELFGEPFSE
Ga0136219_101082533300010227SoilVRLSVVDHGHAPAEATVLAEIREHSGAEPLGVVKTIYYRPELFGRPFSD
Ga0105239_1212751413300010375Corn RhizosphereMRLSVVDNGHAPEQAAVLATIRERSGHEPLGVVKTLMYRPEL
Ga0126383_1011052613300010398Tropical Forest SoilMRLAVVDQGHAPAEAEVLAMIRERSGHEPLGVVKTLLYRPELFG
Ga0134122_1198918713300010400Terrestrial SoilMRLSVVDHGHAPEQAAFLREARERSGREPFGVVKTLLYRPELFGAPFT
Ga0134122_1336502613300010400Terrestrial SoilVRLSVVDSGHAPEHAALLDVIRERSGNEPLGVVKTLLYRPE
Ga0134123_1113432133300010403Terrestrial SoilVRLAVVDHGHRPEEAAVLDMIRERSGNEPLGVVKTLLYRPDLFGRPFSEALDVV
Ga0126350_1092532313300010880Boreal Forest SoilVRLAIIDGGHAPDEAAMLLMIRERTGNEPLGVVKTLLYRPERFGRPFSDALDR
Ga0126350_1211998313300010880Boreal Forest SoilVRLAVLDGGHAPDEVAMLAMIRERTGNEPLGVVKTL
Ga0105246_1010847963300011119Miscanthus RhizosphereMIRLSVVDHGHAPDQAAFLQQARERSGREPFGVVKTLVYRPEIFGGPFTA
Ga0105246_1075363813300011119Miscanthus RhizosphereMRLTVVDNGHAPEQAAVLATIRERSGHEPLGVVKTLMYRP
Ga0137389_1009518753300012096Vadose Zone SoilMRLVAVDAGHAPAEAAVLDQIRERTGREPLGVVKTLLY
Ga0137364_1115809433300012198Vadose Zone SoilLRLAVIDSGHAPDEAAMLAEIRARSGNEPLGVVKTLLYRPELFG
Ga0137383_1073165733300012199Vadose Zone SoilMRLAVVDGGHAPAEAAVLEQIRLHSGREPVGVVKTLLY
Ga0137374_1093237313300012204Vadose Zone SoilMRLTVVDTGHGPNEAAALDQIRQRTGREPLGVVKTLMYRP
Ga0137376_1021691343300012208Vadose Zone SoilMRLAVVDAGHAPAEAAVLDQIRRHSGREPVGVVKTLLYRPELFGRPFS
Ga0137379_1054703643300012209Vadose Zone SoilLRLAVVDSGHAPAEAAALDQIRQRSGRDPLGVVKTLLYRPDLFGRPFSQ
Ga0137379_1118160733300012209Vadose Zone SoilVRLAVVDGGHAPAEAAVLAEIRERSGAEPLGVVKTLLYRPELFGR
Ga0137379_1124184413300012209Vadose Zone SoilMRLAIVDNGHAPGEAAMLAEIRERSGHEPLGVVKTL
Ga0137371_1116672933300012356Vadose Zone SoilMRLAIVDEGHAPPEAAMLAAMQERTGAEPLGVVKTLL
Ga0137361_1073486313300012362Vadose Zone SoilMRLTVVDSGHAPDEAAVLAQIRERTGREPLGVVKT
Ga0150984_10051302333300012469Avena Fatua RhizosphereMRLACVDHGHAPEEAAMLRMIRERSGGEPLGVVKTLLYRPELFGRPFSEELDRVM
Ga0150984_11860914653300012469Avena Fatua RhizosphereMIRLSVVDSGHPPDQAAFLQEARERSGREPFGVIKTLVYRPEIFGEPFT
Ga0157301_1023169533300012911SoilMRLSVVDNGHAPEQAAVLATIRERSGHEPLGVVKTLMDRPELFGLPFS
Ga0157306_1012329113300012912SoilVRLSVVDSGHAPEHAAVLDVIRERSGNEPLGVVKTL
Ga0164298_1086976313300012955SoilVRLAVVDSGHRPEEAAMLAAIRERSGAEPLGVVKTLL
Ga0164303_1017886313300012957SoilVRLAVVDGGHAPAEAAMLDEIRARSGQEPLGVVKTLLYRPELF
Ga0164299_1148025833300012958SoilVRLAVVEHGQAPDEADVLAMIRERSGAEPLGVVKTLLY
Ga0164308_1017385213300012985SoilVRLAVVDHGHRPEEAAVLDVIRERSGNEPLGVVKTLLYRP
Ga0164308_1059796813300012985SoilVRLAVVDSGHRPEEAAMLAAIRERSGAEPLGVVKT
Ga0164304_1029714313300012986SoilVRLGVVDHGHAPDEAAVLAMIRERGGAEPLGVVKTLLYRP
Ga0164306_1074008533300012988SoilMSIRLSVVDHGHAPDEAAMLAMIRERSGAEPLGVV
Ga0164305_1092971613300012989SoilMRLAVVDCGHAAPEVEMLRMIRERSGTEPLGVVKTLLYRPE
Ga0164305_1185840833300012989SoilMRLAVLDEGHAPSEAEMLAAIRERTANEPLGVIKTLLYRPEL
Ga0157374_1151147913300013296Miscanthus RhizosphereMSIRLSVIDHGHAPDEAAMLAMIRERSGAEPLGVVKTLLYRPEL
Ga0157374_1208353533300013296Miscanthus RhizosphereVRLAVVDHGHAPDEAAVLAMIRERSGAGPLGVVKTLLYRPELFGRPFS
Ga0120172_108158323300013765PermafrostMRLTVVDSGHAPDEAAVLDQIRERTGREPLGVVKTLLY
Ga0173483_1003172813300015077SoilVRLSVVDSGHAPEHAAVLDVIRERSGNEPLGVVKTLLYRPEVFGQPFS
Ga0173478_1038528313300015201SoilVRLAVVDHGHRPEEAAVLDMIRERSGNEPLGVVKMLLYRPEVFGRP
Ga0132258_1064634163300015371Arabidopsis RhizosphereMRLGVVDSGHAAPETEMLAMIRERSGTEPLGVVKTLLYRPELFGEAF
Ga0132255_10202251813300015374Arabidopsis RhizosphereVRLAVVDHGHRPEEAAVLDMIRERSGNEPLGVVKTLLYRPEAFGQPFSEALD
Ga0182034_1052085113300016371SoilVIRLAVLDRGHEPEEAAILDVIRERSGNEPLGVVKTLLYRPELF
Ga0163161_1020684233300017792Switchgrass RhizosphereVRLSVVDSGHAPAEAAVLETIRERSGHEPLGVVKTLLYRPE
Ga0163161_1073208613300017792Switchgrass RhizosphereVRLAVVDHGHRPEEADVLDVIRERSGNEPLGVVKTLLYRPDLFGRPF
Ga0187786_1000708323300017944Tropical PeatlandLIRLGVLDRGHAANEAAVLDMIRERSGAEPLGVVKTLLYRPELFAAFASLLNQCPF
Ga0187785_1033435613300017947Tropical PeatlandMRLAVVDQGHAEPEAAMLAAIRENTGNEPLGVIKTLLYRPELFGEPFSQ
Ga0187779_1058870133300017959Tropical PeatlandMIRLDVLDKGHAADEAAILDMIRERSGSEPLGVVKTLLYRPELFG
Ga0187778_1061364133300017961Tropical PeatlandMRLAVVDQGHAPAEAAMLDAIRERAGTEPLGVVKTLLYRPELFGEPFSEAL
Ga0187776_1133521033300017966Tropical PeatlandVRLDVVDRGHAPEEAAVLREIRERSGAEPLGVVKTLLYRPE
Ga0187777_1032111513300017974Tropical PeatlandVRLACVDSGHAPGEAAVLAQIRERSGREPLGVVKTLLYRPELFGGP
Ga0187765_1011620913300018060Tropical PeatlandVRLEAVDSGHAPAEAAVLDEIRARSGAEPLGVVKTLLYRPEL
Ga0187765_1094380333300018060Tropical PeatlandVRLACVEGGHAPGEAAVLAQIRERSGREPLGVVKTLLYRPELFG
Ga0187773_1011750313300018064Tropical PeatlandVRLDVVDHGHAPEEAAVLQEIRERSGAEPLGVVKT
Ga0187774_1081095113300018089Tropical PeatlandMRLAVVDTRHAPTEAAMLAEIRERTGSEPLGVIKTLLYRPELFGEPFSE
Ga0066655_1120358113300018431Grasslands SoilVRLAVLDSGHAPAEREALAVIRERMQAEPLGVVKTLLYRPELFGAPF
Ga0066667_1031351413300018433Grasslands SoilVRLAVVDGGHAPAEAAVLEEIRERSGAEPLGVVKTLHYRPELF
Ga0066667_1185805433300018433Grasslands SoilMRLAIVDGGHAPAEAAILEAIGQRSGAEPLGLVKAPL
Ga0066667_1211575213300018433Grasslands SoilMRLAVVDHGHAPQEAAMLATIREQSRAEPLGGVKTRLYRPE
Ga0066669_1115925013300018482Grasslands SoilMRLDVVDRGHAQPEAAALEAIRDRSGQEPLGVIKTLLYRPDLFGRPFSEALDR
Ga0206350_1001158213300020080Corn, Switchgrass And Miscanthus RhizosphereMRLAVVDHGHTPDRAAMLAEIRERSGGEPLGVVKTLLY
Ga0206354_1084019413300020081Corn, Switchgrass And Miscanthus RhizosphereMRLAVVDSGHLPAEAAVLAEVRERSGAEPLGVVKTL
Ga0193719_1004237543300021344SoilMRLTVVDSGHGPNEAAALDQIRQRTGREPLGVVKTLMYRPELFGMPFS
Ga0222622_1073620113300022756Groundwater SedimentMRLSVIDHGHAPDEAAMLAMIRERSGAEPLGVVKTLLYRPELFGR
Ga0247790_1008830733300022915SoilVRLSVVDSGHAPEHAAVLDVIRERSGNEPLGVVKTLLYRPEVF
Ga0247757_1032277823300023097Plant LitterVRLQVVDQGHRPEEAAVLDMIRERSGREPLGVVKTLLYRPELFGTPFSEALDD
Ga0247789_106258513300023266SoilMRLSVVDNGHAPEQAAVLATIRERSGHEPLGVVKTLMYRPELFG
Ga0247776_1025914113300023275Plant LitterVRLQVVDQGHRPEEAAVLDMIRERSGREPLGVVKTLLYRPELFGTP
Ga0247667_101594743300024290SoilVRLTVVDSGHAPDEAAMLDLIRERSGAEPLGVVKTLLYRPELFGTPFSEELD
Ga0207695_1122833933300025913Corn RhizosphereMRLAVVDQGHAPPEAAMLAAIREGSGAEPLGVVKTLLYRPELFGEPFSEAL
Ga0207671_1018489033300025914Corn RhizosphereMRLAVVDQGHAPPEAAMLAAIREGSGAEPLGVVKTLLYRPELFGEPFSEALDVVMRRLAG
Ga0207671_1057528733300025914Corn RhizosphereVRLAVVDHGHRPEEAAVLDMIRERSGNEPLGVVKTLLYRPDLF
Ga0207693_1115782713300025915Corn, Switchgrass And Miscanthus RhizosphereVIRLSVVDHGHEPDAAAFLQQVRERSGREPLGVVKTLVY
Ga0207652_1176807213300025921Corn RhizosphereVRLQVVDQGHRPEEAAVLDMIRERSGREPLGVVKTLLYRPELFGTPFS
Ga0207646_1122102813300025922Corn, Switchgrass And Miscanthus RhizosphereMRLAVVDAGHAPDEAAVLDQIRERTGREPLGVVKTLLYRPELFGLPFSTAL
Ga0207694_1069536933300025924Corn RhizosphereVRLAVVDHGHRPEEAAVLDMIRERSGNEPLGVVKTLLYLPDL
Ga0207659_1006367153300025926Miscanthus RhizosphereVRLQVVDQGHRPEEAAVLDMIRERSGREPLGVVKTLLYRPELFGTPFSE
Ga0207644_1109314013300025931Switchgrass RhizosphereVRLSVVGSGHAPAEVAVLEAIRERSGHEPLGVVKTLLYRPELFGQP
Ga0207709_1174006713300025935Miscanthus RhizosphereMMRLSVVDRGHAPEQAAFLQTARERSGREPFGVVKTLVYRPEIFGKPFTGE
Ga0207704_1171033933300025938Miscanthus RhizosphereAVTIRLDVVDRGHATAEAAMLDVVRQRSGAEPLGVVKTLLYRPELFGTPSRRRSTR
Ga0207665_1085207933300025939Corn, Switchgrass And Miscanthus RhizosphereMRLAVVDTGHAPAEAAVLDQIRERSGREPLGVVKTLLYRPELFGLPFSLAL
Ga0207665_1142741433300025939Corn, Switchgrass And Miscanthus RhizosphereVLDQGHAPDEAAMLAEIRERSGHEPLGVVKTLLYRPELFG
Ga0207677_1172435733300026023Miscanthus RhizosphereVIRLDVVDHGHAPGEAAMLAEIRERSGQEPLGVVKT
Ga0207678_1138181533300026067Corn RhizosphereVRLAVVDHGHGPEEAAVLDVIRERSGNEPLGVVKTLLYRPEL
Ga0207702_1100693433300026078Corn RhizosphereVRLQVVDQGHRPAEAAVLDMIRERSGREPLGVVKTLLYRPELFG
Ga0207702_1176404433300026078Corn RhizosphereMRLGVVDGGHAAAEAEMLAMIRERSGTEPLGVVKTL
Ga0207674_1036735413300026116Corn RhizosphereVRLAVVDHGHRPEEAAVLDMIRERSGNEPLGVVKTLLY
Ga0207698_1230130113300026142Corn RhizosphereMRLAVVDCGHAAPEAEMLRMIRERSATEPLGVVKTLLYRPELFGETFSAALDVA
Ga0209581_127476423300027706Surface SoilVIRLDCVDHGHSGEAAAMLAEIRERSGREPLGVIKTLLYRSELFGEPFSEELDA
Ga0209811_1013820533300027821Surface SoilMRLSVVDSGHAAGEAAFLEQARQASGREPLGVVKTLLYRPELFGR
Ga0265337_113629733300028556RhizospherePEQAAFLQMARERSGREPLGVVKTLLYRPELFGGPFTD
Ga0265334_1018244633300028573RhizosphereVRLEIVDSGHAPAEAAVLEAMRAEFGREPSGVVKTLYYR
Ga0247828_1078500933300028587SoilVRLSVVDSGHAPEHAALLDVIRERSGNEPLGVVKTLLYRPELFGQPFSEALG
Ga0307284_1008602013300028799SoilVIRLSVVDHGHAPEQAAFLQEARERSGREPFGVVKTLLYRPELFGRPFTGEL
Ga0265324_1022106033300029957RhizosphereMIRLSVVDHGHAPEQAAFLQMARERSGREPLGVVK
Ga0307498_1043894533300031170SoilMRLAVVDQGHAPQEAAMLAAIREQSGVEPLGVVKTLL
Ga0299913_1193646533300031229SoilMRLAVVDHGHGPAEAAVLDAIRERSGAEPLGVVKTLYYRPELFGRAFSDAV
Ga0265327_1015425313300031251RhizosphereMRLGVVDHGHAPDEAAFLADIRERSGREPLGVVKTLLYRPELFGLPFSDAL
Ga0310813_1186612033300031716SoilMRLSVVDNGHAPEQAAVLATIRERSGHEPLGVVKTLMYRPELFGL
Ga0302321_10081783113300031726FenMRLDVVDHGHAPDEAAFLAEIRERSGREPLGVVKTLLYRPELFG
Ga0307468_10121207133300031740Hardwood Forest SoilMSLAVLDEGHAPAEAEMLATIRERAATEPLGVVKTLLYRPQLFGEPFSEALEVAM
Ga0318568_1069334713300031819SoilVRLAVLDEGHAAPEAEMLAAIRERTANEPLGVVKTLL
Ga0310907_1087600623300031847SoilVRLAVVDHGHRPDEAAVLDVIRERSGNEPLGVVKTLLYRPELFGQPFS
Ga0307407_1002837533300031903RhizosphereMRLSVVDSGHGAAETAVLDAIRERSGAEPLGVVKTIYYRPELF
Ga0310900_1132289613300031908SoilVRLSVVDSGHAPEHAALLDVIRERSGNEPLGVVKTLLYRPELFGQPFSEALED
Ga0310916_1076796513300031942SoilVIRLAVLDRGHEPEEAAILDVIRERSGNEPLGVVKTLLYRPELFGTP
Ga0318562_1050403313300032008SoilMRLSVLESGHAPAEAAVLDEMRARSGAEPLDVVKTLLY
Ga0318562_1066479913300032008SoilVIRLAVVDHGHAPAEAAFLRQARERTVRESLGVVKTLLY
Ga0310899_1044135533300032017SoilVRLAVVDHGHRPEEAAVLDMIRERSGNEPLGVVKTLLYL
Ga0318559_1029136313300032039SoilVIRLAVLDRGHEPEEAAILDVIRERSGNEPLGVVK
Ga0318504_1034149513300032063SoilVIRLAVLDRGHEPEEAAILDVIRERSGNEPLGVVKTLLY
Ga0308173_1142626813300032074SoilMRLAVVDRGHAPPEAAMLASIRERTGAEPLGVVKTLLYR
Ga0316583_1027624733300032133RhizosphereMRLAVVDSGHAPAEAAMLAQIRERSGGEPLGVVKTLLYQPELFGEPFSDAL
Ga0307471_10419211613300032180Hardwood Forest SoilVRLAVVDSGHAPDETGVLDQIRERTGREPLGVVKTLLY
Ga0307472_10222360913300032205Hardwood Forest SoilRRCHGRDRVIRLTVVDRGHAPDEAAFLEQARERSGREPFGVV
Ga0315286_1160301513300032342SedimentVRFAVVDHGHAPAEAAILQEIRERTGAEPLGVVKT
Ga0335085_1002359813300032770SoilVIRLTVLDHGHAPAEAAPIAAARAAGREPLGVQKTLLYRPELFGRAFSDELDRAMR
Ga0335081_1052363213300032892SoilMRLEAVDGGHAPPEAAMLAEIAARSGREPLGVVKT
Ga0335069_1043097713300032893SoilVIRLDVIDRGHAADEAAILEIIRERTGNEPLGVVKTLLYWPELFG
Ga0335072_1006253513300032898SoilMRLAVLDEGHAQPESEMLAAIRERTGNEPLGVIKTLLYRPELFGEPFSEALEIV
Ga0318519_1063635813300033290SoilVIRLAVLDRGHEPEEAAILDVIRERSGNEPLGVVKTLLYRPELFGTPFS
Ga0326723_0326408_529_6903300034090Peat SoilMIRLDVLDRGHAPDEAAMLAMIRERSGNEPLGVVKTLLYRPDLFGTPFSEELDR
Ga0370501_0233653_533_6523300034195Untreated Peat SoilMRLAVVDHGHAPAEAAFLAEVRERSGREPLGVVKTLLYRP
Ga0373959_0205506_1_1653300034820Rhizosphere SoilMRLAVVDCGHAAPEAEMLRMIRERSATEPLGVVKTLLYRPELFGEPFSAALDVAM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.