Basic Information | |
---|---|
Family ID | F036109 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 170 |
Average Sequence Length | 45 residues |
Representative Sequence | MPGLRNRRVLLPFITIALFLTMRMLALITPVLGAAMIMLLLDRH |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 170 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Eukaryota |
% of genes with valid RBS motifs | 47.34 % |
% of genes near scaffold ends (potentially truncated) | 31.76 % |
% of genes from short scaffolds (< 2000 bps) | 82.35 % |
Associated GOLD sequencing projects | 109 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Eukaryota (88.824 % of family members) |
NCBI Taxonomy ID | 2759 |
Taxonomy | All Organisms → cellular organisms → Eukaryota |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (15.294 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (37.059 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 170 Family Scaffolds |
---|---|---|
PF00115 | COX1 | 48.82 |
PF00146 | NADHdh | 11.18 |
COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
---|---|---|---|
COG0650 | Formate hydrogenlyase subunit HyfC | Energy production and conversion [C] | 11.18 |
COG1005 | NADH:ubiquinone oxidoreductase subunit 1 (chain H) | Energy production and conversion [C] | 11.18 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.47 % |
Unclassified | root | N/A | 3.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004054|Ga0063232_10250136 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 535 | Open in IMG/M |
3300004769|Ga0007748_11533455 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 712 | Open in IMG/M |
3300004797|Ga0007764_11436441 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 634 | Open in IMG/M |
3300004797|Ga0007764_11594788 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 572 | Open in IMG/M |
3300007170|Ga0099774_1090807 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 559 | Open in IMG/M |
3300007230|Ga0075179_1598585 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1093 | Open in IMG/M |
3300007239|Ga0075171_1439456 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1879 | Open in IMG/M |
3300007239|Ga0075171_1456343 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 986 | Open in IMG/M |
3300007239|Ga0075171_1467684 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1229 | Open in IMG/M |
3300007240|Ga0075176_1105161 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1028 | Open in IMG/M |
3300007240|Ga0075176_1787519 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 683 | Open in IMG/M |
3300007244|Ga0075167_10838256 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 646 | Open in IMG/M |
3300007304|Ga0102689_1002420 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 2074 | Open in IMG/M |
3300007319|Ga0102691_1004517 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1972 | Open in IMG/M |
3300007321|Ga0102692_1139104 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1616 | Open in IMG/M |
3300007534|Ga0102690_1022288 | Not Available | 2089 | Open in IMG/M |
3300007534|Ga0102690_1734617 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 1251 | Open in IMG/M |
3300007623|Ga0102948_1015305 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 2639 | Open in IMG/M |
3300007623|Ga0102948_1194867 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 616 | Open in IMG/M |
3300007777|Ga0105711_1214812 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 603 | Open in IMG/M |
3300008031|Ga0099817_1532559 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1894 | Open in IMG/M |
3300008111|Ga0114344_1093307 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1630 | Open in IMG/M |
3300008116|Ga0114350_1040482 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 1768 | Open in IMG/M |
3300008119|Ga0114354_1029951 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 2418 | Open in IMG/M |
3300008119|Ga0114354_1200672 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 692 | Open in IMG/M |
3300008262|Ga0114337_1212821 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 775 | Open in IMG/M |
3300008832|Ga0103951_10547263 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 628 | Open in IMG/M |
3300008929|Ga0103732_1000072 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 6195 | Open in IMG/M |
3300008936|Ga0103739_1013762 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 998 | Open in IMG/M |
3300008993|Ga0104258_1016464 | Not Available | 1371 | Open in IMG/M |
3300008993|Ga0104258_1023816 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1144 | Open in IMG/M |
3300009011|Ga0105251_10051932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1953 | Open in IMG/M |
3300009095|Ga0079224_101553061 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 939 | Open in IMG/M |
3300009151|Ga0114962_10168240 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
3300009183|Ga0114974_10070763 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 2288 | Open in IMG/M |
3300009185|Ga0114971_10483322 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 694 | Open in IMG/M |
3300009225|Ga0103851_1003700 | Not Available | 1957 | Open in IMG/M |
3300009225|Ga0103851_1045228 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 729 | Open in IMG/M |
3300009235|Ga0103857_10016838 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1228 | Open in IMG/M |
3300009235|Ga0103857_10026689 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1026 | Open in IMG/M |
3300009235|Ga0103857_10115504 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 557 | Open in IMG/M |
3300009235|Ga0103857_10148066 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 502 | Open in IMG/M |
3300009243|Ga0103860_10036505 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 942 | Open in IMG/M |
3300009243|Ga0103860_10037596 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 931 | Open in IMG/M |
3300009247|Ga0103861_10013963 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1039 | Open in IMG/M |
3300009281|Ga0103744_10031790 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1230 | Open in IMG/M |
3300009402|Ga0103742_1021841 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 800 | Open in IMG/M |
3300009432|Ga0115005_10049629 | All Organisms → cellular organisms → Bacteria | 3215 | Open in IMG/M |
3300009433|Ga0115545_1041323 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 1809 | Open in IMG/M |
3300009436|Ga0115008_10440647 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 926 | Open in IMG/M |
3300009449|Ga0115558_1395638 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 540 | Open in IMG/M |
3300009510|Ga0116230_10190512 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1675 | Open in IMG/M |
3300009510|Ga0116230_10575791 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 856 | Open in IMG/M |
3300009543|Ga0115099_10328710 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 692 | Open in IMG/M |
3300009543|Ga0115099_10682484 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 1614 | Open in IMG/M |
3300009592|Ga0115101_1753936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3120 | Open in IMG/M |
3300009599|Ga0115103_1229945 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 989 | Open in IMG/M |
3300009599|Ga0115103_1332127 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 726 | Open in IMG/M |
3300009599|Ga0115103_1332614 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 556 | Open in IMG/M |
3300009599|Ga0115103_1764296 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 2197 | Open in IMG/M |
3300009599|Ga0115103_1886150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2909 | Open in IMG/M |
3300009606|Ga0115102_10133865 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 2088 | Open in IMG/M |
3300009608|Ga0115100_10497540 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 686 | Open in IMG/M |
3300009677|Ga0115104_10258410 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1089 | Open in IMG/M |
3300009677|Ga0115104_10272877 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 2051 | Open in IMG/M |
3300009677|Ga0115104_10369429 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 2039 | Open in IMG/M |
3300009677|Ga0115104_10739383 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 983 | Open in IMG/M |
3300009677|Ga0115104_10970513 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1156 | Open in IMG/M |
3300009677|Ga0115104_11183802 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 533 | Open in IMG/M |
3300009677|Ga0115104_11268080 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1187 | Open in IMG/M |
3300009679|Ga0115105_10304697 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
3300009679|Ga0115105_10304714 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 794 | Open in IMG/M |
3300009679|Ga0115105_10632005 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1975 | Open in IMG/M |
3300009679|Ga0115105_10639305 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 725 | Open in IMG/M |
3300009679|Ga0115105_10738070 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1673 | Open in IMG/M |
3300009679|Ga0115105_10871768 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 704 | Open in IMG/M |
3300009679|Ga0115105_10931643 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 834 | Open in IMG/M |
3300009697|Ga0116231_10098789 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1809 | Open in IMG/M |
3300009697|Ga0116231_10578850 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 614 | Open in IMG/M |
3300009701|Ga0116228_10936963 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 577 | Open in IMG/M |
3300009739|Ga0123362_1019184 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1002 | Open in IMG/M |
3300009750|Ga0123368_1019242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1609 | Open in IMG/M |
3300009750|Ga0123368_1075161 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 715 | Open in IMG/M |
3300009754|Ga0123364_1032973 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 958 | Open in IMG/M |
3300009756|Ga0123366_1001850 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 806 | Open in IMG/M |
3300009873|Ga0131077_10422881 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 1592 | Open in IMG/M |
3300010135|Ga0123382_1048608 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1664 | Open in IMG/M |
3300010188|Ga0127505_1091574 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 639 | Open in IMG/M |
3300010198|Ga0127509_1033524 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1289 | Open in IMG/M |
3300010430|Ga0118733_103212779 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 892 | Open in IMG/M |
3300010885|Ga0133913_11123306 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 2022 | Open in IMG/M |
3300011081|Ga0138575_1071209 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1332 | Open in IMG/M |
3300012212|Ga0150985_100076913 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 777 | Open in IMG/M |
3300012212|Ga0150985_105891426 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 567 | Open in IMG/M |
3300012212|Ga0150985_107738208 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1975 | Open in IMG/M |
3300012212|Ga0150985_107988573 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 620 | Open in IMG/M |
3300012212|Ga0150985_108564357 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 519 | Open in IMG/M |
3300012212|Ga0150985_111532283 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1177 | Open in IMG/M |
3300012212|Ga0150985_111580517 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 988 | Open in IMG/M |
3300012212|Ga0150985_111930990 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 694 | Open in IMG/M |
3300012212|Ga0150985_112591226 | All Organisms → cellular organisms → Bacteria | 1901 | Open in IMG/M |
3300012212|Ga0150985_112637793 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 558 | Open in IMG/M |
3300012212|Ga0150985_116840373 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1444 | Open in IMG/M |
3300012212|Ga0150985_118807734 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 2926 | Open in IMG/M |
3300012212|Ga0150985_119171701 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 762 | Open in IMG/M |
3300012212|Ga0150985_119454322 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1046 | Open in IMG/M |
3300012212|Ga0150985_122318166 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 602 | Open in IMG/M |
3300012413|Ga0138258_1258660 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 3048 | Open in IMG/M |
3300012413|Ga0138258_1637752 | All Organisms → cellular organisms → Bacteria | 2989 | Open in IMG/M |
3300012415|Ga0138263_1206607 | All Organisms → cellular organisms → Bacteria | 4300 | Open in IMG/M |
3300012417|Ga0138262_1211931 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 777 | Open in IMG/M |
3300012419|Ga0138260_10055995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3001 | Open in IMG/M |
3300012419|Ga0138260_10742423 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 686 | Open in IMG/M |
3300012469|Ga0150984_108759198 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 604 | Open in IMG/M |
3300012469|Ga0150984_116487222 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1942 | Open in IMG/M |
3300012469|Ga0150984_116713815 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 2073 | Open in IMG/M |
3300012469|Ga0150984_120687952 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 516 | Open in IMG/M |
3300012518|Ga0129349_1359915 | All Organisms → cellular organisms → Bacteria | 3113 | Open in IMG/M |
3300012525|Ga0129353_1112883 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 699 | Open in IMG/M |
3300012686|Ga0157560_1113071 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 796 | Open in IMG/M |
3300012687|Ga0157543_1066480 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1335 | Open in IMG/M |
3300012687|Ga0157543_1114365 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 1457 | Open in IMG/M |
3300012688|Ga0157541_1211324 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1046 | Open in IMG/M |
3300012706|Ga0157627_1172405 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 584 | Open in IMG/M |
3300012710|Ga0157550_1197202 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1038 | Open in IMG/M |
3300012713|Ga0157544_1115396 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1401 | Open in IMG/M |
3300012717|Ga0157609_1215546 | Not Available | 1062 | Open in IMG/M |
3300012724|Ga0157611_1256967 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1036 | Open in IMG/M |
3300012730|Ga0157602_1057324 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 936 | Open in IMG/M |
3300012748|Ga0157553_1037587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
3300012755|Ga0138281_1163560 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 764 | Open in IMG/M |
3300012756|Ga0138272_1034708 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 851 | Open in IMG/M |
3300012756|Ga0138272_1037392 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 625 | Open in IMG/M |
3300012758|Ga0138285_1052456 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1085 | Open in IMG/M |
3300012760|Ga0138273_1204083 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 846 | Open in IMG/M |
3300012761|Ga0138288_1160368 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1234 | Open in IMG/M |
3300012770|Ga0138291_1220721 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 601 | Open in IMG/M |
3300012780|Ga0138271_1288551 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 653 | Open in IMG/M |
3300012780|Ga0138271_1309152 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 743 | Open in IMG/M |
3300012782|Ga0138268_1626535 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 740 | Open in IMG/M |
3300012942|Ga0164242_10003303 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 18443 | Open in IMG/M |
3300012943|Ga0164241_10983436 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 619 | Open in IMG/M |
3300012954|Ga0163111_10049338 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 3269 | Open in IMG/M |
3300012956|Ga0154020_10007916 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 12363 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10014832 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 8804 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10182817 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1448 | Open in IMG/M |
3300013295|Ga0170791_10145014 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1774 | Open in IMG/M |
3300013295|Ga0170791_11194880 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 1919 | Open in IMG/M |
3300013295|Ga0170791_12642153 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 773 | Open in IMG/M |
3300013295|Ga0170791_13120186 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 635 | Open in IMG/M |
3300014832|Ga0119905_1064998 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 996 | Open in IMG/M |
3300015350|Ga0182163_1184734 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 652 | Open in IMG/M |
3300018996|Ga0192916_10003770 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 2311 | Open in IMG/M |
3300021312|Ga0210306_1191754 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 712 | Open in IMG/M |
3300021359|Ga0206689_10492489 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 653 | Open in IMG/M |
3300021967|Ga0213848_1095263 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 899 | Open in IMG/M |
3300024546|Ga0256356_1016927 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1306 | Open in IMG/M |
3300028330|Ga0247601_1000688 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 3321 | Open in IMG/M |
3300030587|Ga0257209_1023891 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 804 | Open in IMG/M |
3300032758|Ga0314746_1010748 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 1760 | Open in IMG/M |
3300032934|Ga0314741_1055455 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 919 | Open in IMG/M |
3300033978|Ga0334977_0283820 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 802 | Open in IMG/M |
3300033979|Ga0334978_0412194 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 636 | Open in IMG/M |
3300033981|Ga0334982_0226983 | Not Available | 909 | Open in IMG/M |
3300033981|Ga0334982_0514895 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 527 | Open in IMG/M |
3300034013|Ga0334991_0018266 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 4164 | Open in IMG/M |
3300034019|Ga0334998_0148707 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 1503 | Open in IMG/M |
3300034072|Ga0310127_001897 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 22567 | Open in IMG/M |
3300034652|Ga0316598_078836 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 907 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 15.29% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.18% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 8.82% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.65% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.29% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 5.29% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.71% |
Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 4.71% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 4.12% |
Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 4.12% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.94% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.35% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.35% |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 1.76% |
Ice Edge, Mcmurdo Sound, Antarctica | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica | 1.76% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.18% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.18% |
Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.18% |
Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 1.18% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.59% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.59% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.59% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.59% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.59% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.59% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.59% |
Diffuse Vent Fluid, Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents | 0.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.59% |
Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.59% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.59% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.59% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.59% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.59% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
Coral | Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral | 0.59% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.59% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.59% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.59% |
Activated Sludge | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge | 0.59% |
Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007170 | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_A4L_L (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300007230 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
3300007239 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B2 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
3300007240 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
3300007244 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007319 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007321 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007534 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
3300007777 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS918_NRZ_DNA CLC_assembly | Environmental | Open in IMG/M |
3300008031 | Coral microbial communities from Puerto Morelos, Mexico - Siderastrea C B metatranscriptome (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008832 | Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150 | Environmental | Open in IMG/M |
3300008929 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1A | Environmental | Open in IMG/M |
3300008936 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3B | Environmental | Open in IMG/M |
3300008993 | Marine microbial communities from eastern North Pacific Ocean - P1 free-living | Environmental | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009225 | Microbial communities of water from Amazon river, Brazil - RCM4 | Environmental | Open in IMG/M |
3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
3300009247 | Microbial communities of water from Amazon river, Brazil - RCM14 | Environmental | Open in IMG/M |
3300009281 | Microbial communities of wastewater sludge from Singapore - Sludge_b1_October | Environmental | Open in IMG/M |
3300009402 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4B | Environmental | Open in IMG/M |
3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
3300009510 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009592 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009697 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
3300009739 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_194_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009750 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_206_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009754 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_198_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009756 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_202_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010135 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_257_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010188 | Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
3300010198 | Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011081 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012413 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012415 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012417 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012419 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012518 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012686 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES055 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012687 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES032 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012688 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES030 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012710 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES041 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012713 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES033 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012748 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES045 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012755 | Freshwater microbial communities from Lake Montjoie, Canada - M_140807_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012756 | Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012758 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130626_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012760 | Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012761 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012770 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012780 | Freshwater microbial communities from Lake Croche, Canada - C_130625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012782 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012942 | Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG) | Environmental | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300014832 | Activated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M90108 | Engineered | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300018996 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156) | Environmental | Open in IMG/M |
3300021312 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021359 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021967 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - AB:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024546 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028330 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 76R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030587 | Metatranscriptome of plant litter fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF3-LITTER (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
3300034652 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0063232_102501361 | 3300004054 | Freshwater Lake | MPGLRNRRVLLPFITISLLLTLRMLAIITPVLGASMFMLLMDRH* |
Ga0007748_115334552 | 3300004769 | Freshwater Lake | MPGLRNRRVLLPFITISLLLTLRMLAVITPVLGASMFMLLMDRH* |
Ga0007764_114364412 | 3300004797 | Freshwater Lake | MPGMRHRRILLPFVTIGILFAFRMLALITPVLAAAMIMMALDRH*Q |
Ga0007764_115947882 | 3300004797 | Freshwater Lake | MPGLRNRRILLPFISISLFLTMRMLAIVTPVLGAAMIMLFMDRH* |
Ga0099774_10908071 | 3300007170 | Activated Sludge | MPGLRNRKILMPFISINLFLTMRMLSMIVPVLGAAMIMLQLDRHFNFSFFDY |
Ga0075179_15985851 | 3300007230 | Wastewater Effluent | SAPGLRNRRVLVPFISITLFLVMRMLALITPVLGAALIMLLMDRH* |
Ga0075171_14394562 | 3300007239 | Wastewater Effluent | CMPGMRHRRILLPFITISMLFCLRMLALITPVLGAAVIMMALDRH* |
Ga0075171_14563431 | 3300007239 | Wastewater Effluent | NLLITRRTLCMPGMRHRRILLPFITISMLFCLRMLALITPVLGAAVIMMALDRH* |
Ga0075171_14676842 | 3300007239 | Wastewater Effluent | MPGLRNRRILLPFVSIGLFLALRMLAIITPVLAAAMIMMALDRH* |
Ga0075176_11051611 | 3300007240 | Wastewater Effluent | MPGMRHRRILLPFITISILFCLRMLALITPVLGAAVIMMALDRH* |
Ga0075176_17875191 | 3300007240 | Wastewater Effluent | MPGMRHRRILLPFITISMLFCLRMLALITPVLGAAVIMMALDRH* |
Ga0075167_100633212 | 3300007244 | Wastewater Effluent | LLVTRRTLAMPGLRNRRILLPFTSITILLMLRALAIITPVLGSAMLMLLLDRH* |
Ga0075167_108382561 | 3300007244 | Wastewater Effluent | RRTLSMPGLRNRRVLLPFLTITLFLTMRMLTLITPVLGGAMIMLYLDRH* |
Ga0102689_10024203 | 3300007304 | Freshwater Lake | MPGLRYRRILLPFLSIALFLTMRMLALITPVLAAAMIMLVMDRH* |
Ga0102691_10045172 | 3300007319 | Freshwater Lake | MPGLRNRRVLLPFVTISLFLTMRMLALVTPVLGAAMIMLLMDRH* |
Ga0102692_11391043 | 3300007321 | Freshwater Lake | MPGLRNRRVLLPFVTIATLLALRLLVPITPVLAAAMIMMALDRH* |
Ga0102690_10222884 | 3300007534 | Freshwater Lake | MPGLRNRRVLLPFITITILLMLRALSVITPVLGSAMLMLLTDRH* |
Ga0102690_17346173 | 3300007534 | Freshwater Lake | MPGLRNRRVLLPFITIALFLTMRMLALVTPVLGAAMIMLMMDRH* |
Ga0102948_10153051 | 3300007623 | Water | MPGLRNRRVLVPFLSIALFLVMRMLALITPVLGAAMLMLLMDRH* |
Ga0102948_11948671 | 3300007623 | Water | LRNRRVLVPFLSTALFLVMRMLALITPVLGAAMLMLLMDRH* |
Ga0105711_12148121 | 3300007777 | Diffuse Vent Fluid, Hydrothermal Vents | MPGMRHRRILLPFVSISIFFSLRMLAIITPVLGAAMIMMALDRH* |
Ga0099817_15325593 | 3300008031 | Coral | MPGMRHRRVLLPFVTIGIFFAFRMLAIITPVLGAAMIMMALDRH* |
Ga0114344_10933071 | 3300008111 | Freshwater, Plankton | TNLLITRRTLSMPGLRYRRVLLPFISIALFLTMRMLVLITPVLAAAMIMLALDRH* |
Ga0114350_10404822 | 3300008116 | Freshwater, Plankton | MPGLRNRRVLLPFITIALFLTMRMLALVTPVLGAAMIMLLMDRH* |
Ga0114354_10299511 | 3300008119 | Freshwater, Plankton | MPGLRNRRVLLPFVTIALFLTMRMLALVTPVLGAAMIMLLMDRH* |
Ga0114354_12006722 | 3300008119 | Freshwater, Plankton | MPGLRNRRVLLPFVTISLFLTMRMLALVTPVLGAAMIMLMMDRH* |
Ga0114337_12128211 | 3300008262 | Freshwater, Plankton | MPGLRNRRVLLPFITISLFLTMRMLALVTPVLGAAMIMLLMDRH* |
Ga0103951_105472631 | 3300008832 | Marine | NRRFLMPFLTIAVLLTLRFLALITPVLGGCMIMIFTDRH* |
Ga0103732_10000724 | 3300008929 | Ice Edge, Mcmurdo Sound, Antarctica | MPGLRNRRVLIPFVTISLFLTMRMLSIITPVLGAALLMLLMDRH* |
Ga0103739_10137621 | 3300008936 | Ice Edge, Mcmurdo Sound, Antarctica | RNRRVLLPFISIALFLTMRMLAIVTPILGASMVMLFMDRH* |
Ga0104258_10164641 | 3300008993 | Ocean Water | LPFISIALFLTMRMLAIVTPILGASMVMLFMDRH* |
Ga0104258_10238161 | 3300008993 | Ocean Water | AMPGLRNRRVLLPFVTISLFLTMRMLALVTPVLGAAMIMLLMDRH* |
Ga0105251_100519322 | 3300009011 | Switchgrass Rhizosphere | MPGLRNRRVLLPFVTIALFLTMRMLALITPVLGAAMIMLLLDRH* |
Ga0079224_1015530612 | 3300009095 | Agricultural Soil | MPGLRYRRILLPFISIALFLTMRMLALITPVLAAAMIMLVLDRH* |
Ga0114962_101682401 | 3300009151 | Freshwater Lake | MPGIRHRRVLLPFISIGIFLALRMLAIITPVLAAAMIMMALDRH* |
Ga0114974_100707632 | 3300009183 | Freshwater Lake | MPGLRNRRVLLPFITIALFLTMRMLALVTPVLAAAMIMLMMDRH* |
Ga0114971_104833223 | 3300009185 | Freshwater Lake | NRRVLLPFISIFLFLIMRILAIVTPVLGAAMIMLLMDRH* |
Ga0103851_10037001 | 3300009225 | River Water | TRRTLSMPGLRHRRVLLPFISIGIFLALRMLAIITPVLAAAMIMMALDRH* |
Ga0103851_10452281 | 3300009225 | River Water | MPGLRHRRVLLPFISIGIFSALRMLAIITPVLAAAMIMMALDRH* |
Ga0103857_100168384 | 3300009235 | River Water | LRNRRILLPFVTIGLFLAMRMLAIITPVLAAAMIMMALDRH* |
Ga0103857_100266892 | 3300009235 | River Water | MPGMRHRRILLPFITIGTLLSLRMLAIITPVLAAAMIMMDLDRH* |
Ga0103857_101155042 | 3300009235 | River Water | MPGMRHRRILLPFVSIGIFFALRMLALITPVLAAAMVMMIL |
Ga0103857_101480662 | 3300009235 | River Water | MPGLRNRRVLIPFLTITLFLTMRMLTLITPVLGGAMIMLYLDRH* |
Ga0103860_100365052 | 3300009243 | River Water | MPGMRHRRILLPFITIGTLLSLRMLAIITPVLAAAMIMMALDRH* |
Ga0103860_100375962 | 3300009243 | River Water | MPGLKNRRILMPFITIAILLTLRMLAIITPVLAAAMIMMALDRH* |
Ga0103861_100139631 | 3300009247 | River Water | MPGMRHRRVLLPFVTIGIFFAFRMLAIITPVLAAAMIMMILDRH* |
Ga0103744_100317903 | 3300009281 | Wastewater Sludge | MPGLKNKKSLIPFLSITLFLTLRMLALITPVLGGAMMMLEFDRH* |
Ga0103742_10218411 | 3300009402 | Ice Edge, Mcmurdo Sound, Antarctica | GLKNRRVLIPFITISLFLTMRMLSIITPVLGAALLMLLMDRH* |
Ga0115005_100496295 | 3300009432 | Marine | MPGLRNRRILLPFITIALLLTLRMLAIITPVLGASMFMLLMDRH* |
Ga0115545_10413231 | 3300009433 | Pelagic Marine | MPGLRNRRVLLPFITIALLLTLRMLAIITPVLGASMFMLLMDRH* |
Ga0115008_104406472 | 3300009436 | Marine | MPGLKNRRVLIPFVTISLFLTMRMLTIITPVLGAALLMLLMDRH* |
Ga0115558_13956382 | 3300009449 | Pelagic Marine | TNLLITRRTLAMPGLRKRRVLLPFITIALLLTLRMLAVITPVLGASMFMLLMDRH* |
Ga0116230_101905124 | 3300009510 | Host-Associated | MPGLRNRRVLLPFITIALFLTMRMLALVTPVLGAAMIMLLLDRH* |
Ga0116230_105757912 | 3300009510 | Host-Associated | TNLLITRRTLTMPGMKHRRILLPFVSIGIFFAFRMLALITPVLAAAMIMIILDRH* |
Ga0115099_103287102 | 3300009543 | Marine | MPGLRNRRVLLPFISISLFLTMRMLAIVTPILGASMVMLFMDRH* |
Ga0115099_106824843 | 3300009543 | Marine | MPGLRNRRILLPFISISLFLTMRMLAIVTPVLGAAMLMLFMDRH* |
Ga0115101_17539362 | 3300009592 | Marine | MPGLRNRRVLMPFISIALFLTMRMLAIVTPVLGAAMIMLFMDRH* |
Ga0115103_12299451 | 3300009599 | Marine | RRVLLPFISIALFLTMRMLAIVTPILGASMVMLFMDRH* |
Ga0115103_13321271 | 3300009599 | Marine | MPGMRHRRVLMPFVTIGTLFALRMLAIITPVLGAAMIMMALDRH* |
Ga0115103_13326141 | 3300009599 | Marine | MPGMRHRRVLMPFITIGTLFALRMLAIITPVLGAAMIMMALDRH* |
Ga0115103_17642962 | 3300009599 | Marine | MPGLRNRRVLLPFITISLFLTMRMLALVTPVLGAAMVMLLMDRH* |
Ga0115103_18861502 | 3300009599 | Marine | MPGLRNRRVLLPFVTIGLFLTMRMLAIVTPVLGASMFMLLMDRH* |
Ga0115102_101338654 | 3300009606 | Marine | MPGLRNRRVLLPFISIALFLTMRMLAIVTPILGASMVMLFMDRH* |
Ga0115100_104975402 | 3300009608 | Marine | LVTRRTLAMPGLRNRRVLLPFISIALFLTMRMLAIVTPILGASMVMLFMDRH* |
Ga0115104_102584101 | 3300009677 | Marine | RVLLPFSTIGTLLALRMLAIITPVLAAAMIMMMLDRH* |
Ga0115104_102728772 | 3300009677 | Marine | MPGLRNRRVLLPFVTIALFLTMRMLALVTPVLGAAMVMLLMDRH* |
Ga0115104_103694293 | 3300009677 | Marine | MPGLRNRRVLLPFVTIALFLTMRMLAIVTPVLGAAMIMLLMDRH* |
Ga0115104_107393832 | 3300009677 | Marine | NRRVLLPFSTIGTLLALRMLAIITPVLGAAMIMMMLDRH* |
Ga0115104_109705132 | 3300009677 | Marine | MPGMRNRRVLLPFSTIGTLLALRMLALVTPVLAAAMIMMMLDRH* |
Ga0115104_111838021 | 3300009677 | Marine | TRRTLAMPGLRNRRVLLPFISISLFLTMRMLAIVTPILGASMVMLFMDRH* |
Ga0115104_112680802 | 3300009677 | Marine | MPGLRNRRVLLPFVTISLFLTMRMLALVTPVLAAAMIMLLMDRH* |
Ga0115105_103046972 | 3300009679 | Marine | MPGMRNRRVLLPFSTIGTLLALRMLAIITPVLGAAMIMMMLDRH* |
Ga0115105_103047141 | 3300009679 | Marine | RTLAMPGMRNRRVLLPFSTIGTLLALRMLAIITPVLGAAMIMMMLDRH* |
Ga0115105_106320052 | 3300009679 | Marine | MPGMRNRRVLLPFSTIGTLLALRMLALVTPVLGAAMIMMSLDRH* |
Ga0115105_106393051 | 3300009679 | Marine | LVTRRTLAMPGMRNRRVLLPFSTIGTLLALRMLAIITPVLGAAMIMMMLDRH* |
Ga0115105_107380702 | 3300009679 | Marine | MPGMRNRRVLLPFATIGILLALRLLALVTPVLAAAMIMMELDRH* |
Ga0115105_108717681 | 3300009679 | Marine | MPGMRNRRVLLPFSTIGTLLALRMLAIITPVLGAAMIMMLLDRH* |
Ga0115105_109316431 | 3300009679 | Marine | MPGMRNRRVLLPFSTIGTLLALRMLALVTPVLGAAMIMMMLDRH* |
Ga0116231_100987892 | 3300009697 | Host-Associated | MPGMRNRRILLPFVSLGIFFAFRMLALITPVLAAAMIMMILDRH* |
Ga0116231_105788501 | 3300009697 | Host-Associated | MPGMRHRRILLPFVSIGIFFAFRMLALVTPVLAAAMIMLLCDRH* |
Ga0116228_109369631 | 3300009701 | Host-Associated | MPGMRHRRILLPFVSIGIFFAFRMLALITPVLAAAMIMMILDRH* |
Ga0123362_10191841 | 3300009739 | Marine | MPGMRHRRVLLPFVSIGIFFALRMLALITPVLAAAMVMMVLDRH* |
Ga0123368_10192422 | 3300009750 | Marine | MPGLRNRRALIPFITIALLLVLRMLAIITPVLGAAMFMLLMDRH* |
Ga0123368_10751611 | 3300009750 | Marine | MPGMRHRRVLLPFITIGTLFALRMLAAITPVLGAAMIMMALDRH* |
Ga0123364_10329732 | 3300009754 | Marine | MPGLRNRRALIPFITISLLLVLRMLAIITPVLGAAMFMLLMDRH* |
Ga0123366_10018501 | 3300009756 | Marine | RNRRVLLPFITIALLLTLRMLAIITPVLGASMFMLLMDRH* |
Ga0131077_104228812 | 3300009873 | Wastewater | MPGLRNRKVLIPFITISLLLTMRMLAIVTPVLGAAMFMLLMDRH* |
Ga0123382_10486083 | 3300010135 | Marine | MPGMRHRRVLLPFITIGTFFAFRMLAIITPVLGAAMVMMALDRH* |
Ga0127505_10915741 | 3300010188 | Host-Associated | MPGMRHRRILLPFITISILFTLRMLALITPVLGAAVIMMALDRH* |
Ga0127509_10335242 | 3300010198 | Host-Associated | MPGMRNRRILLPFVSIGIFFAFRMLALITPVLAAAMIMMILDRH* |
Ga0118733_1032127792 | 3300010430 | Marine Sediment | MPGMRHRRVLLPFITIGIFFAFRMLAIITPVLGAAMIMMALDRH* |
Ga0133913_111233062 | 3300010885 | Freshwater Lake | MPGLRNRRVLLPFISISLFLTMRMLAIVTPVLGAAMIMLLMDRH* |
Ga0138575_10712092 | 3300011081 | Peatlands Soil | MPGIRHRRILLPFISIGIFFAFRMLALITPVLGAAMIMMILDRH* |
Ga0150985_1000769131 | 3300012212 | Avena Fatua Rhizosphere | MPGLRNRRVLLPFITIALFLTMRMLALITPVLGAAMIMLLLDRH* |
Ga0150985_1058914261 | 3300012212 | Avena Fatua Rhizosphere | MPGLRNRRVLLPFMTIALFLTMRMLALITPVIAGAMIMLLLDRH* |
Ga0150985_1077382083 | 3300012212 | Avena Fatua Rhizosphere | MPGLRNRRVLLPFMTIALFLTMRMLALITPVLGAAMIMLLLDRH* |
Ga0150985_1079885732 | 3300012212 | Avena Fatua Rhizosphere | MPGLRNRRVLMPFITISLFLTMRMLALVTPVLGAAMIMLLLDRH* |
Ga0150985_1085643571 | 3300012212 | Avena Fatua Rhizosphere | MPGLRNRRVLLPFITIALFLTMRMLALVTPVLAAAMIMLLMDRH* |
Ga0150985_1115322831 | 3300012212 | Avena Fatua Rhizosphere | PGLRNRRVLLPFITIALFLTMRMLALVTPVLGAAMIMLLLDRH* |
Ga0150985_1115805172 | 3300012212 | Avena Fatua Rhizosphere | MPGLRNRRVLLPFITIALFLTMRMLALVTPVLGAAMVMLLLDRH* |
Ga0150985_1119309901 | 3300012212 | Avena Fatua Rhizosphere | MPGLRNRRVLLPFMTIALFLTMRMLALVTPVLGAAMIMLLLDRH* |
Ga0150985_1125912262 | 3300012212 | Avena Fatua Rhizosphere | MPGLRNRRVLLPFITIALFLTMRMLALITPVLAAAMIMLLADRH* |
Ga0150985_1126377931 | 3300012212 | Avena Fatua Rhizosphere | MPGLRNRRVLLPFITISLFLTMRMLALVTPVLGAAMIMLLLDRH* |
Ga0150985_1168403733 | 3300012212 | Avena Fatua Rhizosphere | MPGLRHRKHLLPFVTIGLLLAMRMLALITPVLAAAMFMMLLDRH* |
Ga0150985_1188077345 | 3300012212 | Avena Fatua Rhizosphere | MPGLRNRKHLLPFVTIGLLLAMRLLALITPVLAAAMIMMILDRH* |
Ga0150985_1191717011 | 3300012212 | Avena Fatua Rhizosphere | MPGLRYRRVLLPFLTIALFLTMRMLALITPVLAGAMIMLILDRH* |
Ga0150985_1194543222 | 3300012212 | Avena Fatua Rhizosphere | HRKHLLPFVTIGLLLAMRMLALITPVLAAAMFMMLLDRH* |
Ga0150985_1223181662 | 3300012212 | Avena Fatua Rhizosphere | LLPFMTIALFLTMRMLALITPVLGAAMIMLLLDRH* |
Ga0138258_12586602 | 3300012413 | Polar Marine | MPGMRHRRVLLPFVTIGTLFALRMLAIITPVLGAAMIMMALDRH* |
Ga0138258_16377522 | 3300012413 | Polar Marine | MPGLRHRRVLLPFVTIGIFFAFRMLAIITPVLGAAMIMMALDRH* |
Ga0138263_12066072 | 3300012415 | Polar Marine | MPGLRHRRVLLPFVTIGIFFAFRMLAIITPFLGAAMIMMALDRH* |
Ga0138262_12119311 | 3300012417 | Polar Marine | RTLCMPGMRHRRVLLPFVTIGMLFALRMLAIITPVLGAAMIMMALDRH* |
Ga0138260_100559952 | 3300012419 | Polar Marine | MPGMRHRRVLLPFVTIGIFFAFRMLAIITPVLGAAMIMMALDRHWQTTFF* |
Ga0138260_107424231 | 3300012419 | Polar Marine | NRRVLIPFVTISLFLTMRMLTIITPVLGAALLMLLMDRH* |
Ga0150984_1087591981 | 3300012469 | Avena Fatua Rhizosphere | MPGLRNRRVLLPFMTISLFLTMRMLALITPVLGAAMIMLLLDRH* |
Ga0150984_1164872222 | 3300012469 | Avena Fatua Rhizosphere | MPGMRHRRVLLPFVSIGIFFAFRMLALITPVLGAAMIMMALDRH* |
Ga0150984_1167138153 | 3300012469 | Avena Fatua Rhizosphere | MPGLRYRRVLLPFISIALFLTMRMLVLITPVLAAAMIMLALDRH* |
Ga0150984_1206879521 | 3300012469 | Avena Fatua Rhizosphere | MPGMRHRRILLPFVTIGVLFALRMLAAITPVLGAAMIMMALDRH* |
Ga0129349_13599155 | 3300012518 | Aqueous | MPGLRNRRVLLPFITISLFLTMRMLAIVTPVLGASMVMLLMDRH* |
Ga0129353_11128831 | 3300012525 | Aqueous | LAMPGLRNRRVLLPFITISLFLTMRMLAIVTPVLGASMVMLLMDRH* |
Ga0157560_11130711 | 3300012686 | Freshwater | MPGLRNRRVLLPFITIALFLTMRMLALVTPVLAAAMVMLLMDRH* |
Ga0157543_10664803 | 3300012687 | Freshwater | MPGLRNRRVLLPFISIALFLTMRMLALVTPVLAAAMIMLLMDRH* |
Ga0157543_11143654 | 3300012687 | Freshwater | MPGLRYRRVLMPFISIALFLTMRMLVLITPVLAAAMIMLALDRH* |
Ga0157541_12113241 | 3300012688 | Freshwater | VLLPFITISLLLTLRMLAIITPVLGASMFMLLMDRH* |
Ga0157627_11724051 | 3300012706 | Freshwater | RTLAMPGLRNRRVLLPFVTIALFLTMRMLALVTPVLGAAMIMLLMDRH* |
Ga0157550_11972021 | 3300012710 | Freshwater | VLMPFISIALFLTMRMLVLITPVLAAAMIMLALDRH* |
Ga0157544_11153961 | 3300012713 | Freshwater | TNLLITRRTLAMPGLRNRRVLLPFITISLLLTLRMLAIITPVLGASMFMLLMDRH* |
Ga0157609_12155461 | 3300012717 | Freshwater | RNRRVLLPFVTISLLLTLRMLAIITPVLGASMFMLLMDRH* |
Ga0157611_12569671 | 3300012724 | Freshwater | NRRVLLPFVTIATLLALRLLVPITPVLAAAMIMMALDRH* |
Ga0157602_10573241 | 3300012730 | Freshwater | AMPGLRNRRVLLPFVTISLFLTMRMLALVTPVLGAAMIMLMMDRH* |
Ga0157553_10375871 | 3300012748 | Freshwater | ITRRTLAMPGLRNRRVLLPFITISLLLTLRMLAIITPVLGASMFMLLMDRH* |
Ga0138281_11635601 | 3300012755 | Freshwater Lake | RRTLAMPGLRNRRVLLPFITISLLLTLRMLAVITPVLGASMFMLLMDRH* |
Ga0138272_10347081 | 3300012756 | Freshwater Lake | RTLAMPGLRNRRILLPFITIALLLTLRMLAAITPVLGASMFMLLMDRH* |
Ga0138272_10373921 | 3300012756 | Freshwater Lake | MPGLRNRRVLLPFISISLFLTMRMLALVTPVLAAAMIMLLMDRH* |
Ga0138285_10524563 | 3300012758 | Freshwater Lake | RRVLLPFISISLFLTMRMLAIVTPVLGAAMIMLFMDRH* |
Ga0138273_12040831 | 3300012760 | Freshwater Lake | NRRILLPFISISLFLTMRMLAIVTPVLGAAMIMLFMDRH* |
Ga0138288_11603681 | 3300012761 | Freshwater Lake | MPGLRNRRVLLPFITISILLTLRMLAVVTPVLGASMFMLLMDRH* |
Ga0138291_12207211 | 3300012770 | Freshwater Lake | TLSMPGLKHRKTLIPFLSINLFLTMRMLALITPVLAAAMIMLQLDRH* |
Ga0138271_12885511 | 3300012780 | Freshwater Lake | RRTLSMPGMRYRRILLPFITISLFLTMRMLAIVTPILGAAMIMLFMDRH* |
Ga0138271_13091522 | 3300012780 | Freshwater Lake | PGLRNRRILLPFISISLFLTMRMLAIVTPVLGAAMIMLFMDRH* |
Ga0138268_16265352 | 3300012782 | Polar Marine | MPGMRHRRVLLPFVTIGIFFSFRMLAIITPVLGAAMIMMALDRH* |
Ga0164242_100033035 | 3300012942 | Compost | MPGLRNRRVLMPFITISLFLTMRMLALITPVLGAAMIMLLLDRH* |
Ga0164241_109834361 | 3300012943 | Soil | MPGLRYRRILLPFISIALFLTMRMLALITPVLAAGMIMLLLDRH* |
Ga0163111_100493382 | 3300012954 | Surface Seawater | LAAPGFKNRKNTIPFLSISLFLVMRMLALITPVLGAAMVMLLMDRH* |
Ga0154020_100079168 | 3300012956 | Active Sludge | MPGLRNRRVLLPFVTITTLLALRLLVPITPVLGAAMIMMALDRH* |
(restricted) Ga0172373_1001483212 | 3300013131 | Freshwater | MPGMRNRRALMPFITIALLLTMRMLAAVTPVLAAAMFMLLMDRH* |
(restricted) Ga0172373_101828173 | 3300013131 | Freshwater | MPGMRHRRILLPFITITILFSLRMLALITPVLGAAMIMMMLDRH* |
Ga0170791_101450143 | 3300013295 | Freshwater | MPGLRSRRVLLPFITISLFLTMRMLAIVTPVLGAAMIMLFMDRH* |
Ga0170791_111948803 | 3300013295 | Freshwater | MPGLRNRRVLLPFITIALFLTMRMLALVTPVLAAAMIILMMDRH* |
Ga0170791_126421531 | 3300013295 | Freshwater | MPGMRHRRILLPFITIGTLLALRMLAIITPVLAAAMIMMTLDRH* |
Ga0170791_131201861 | 3300013295 | Freshwater | MPGLRNRRVLLPFISIALFLTMRMLALVTPVLAAAMIMLMMDRH* |
Ga0119905_10649981 | 3300014832 | Activated Sludge | MPGMRHRRILLPFVTIGTLFAFRMLAIVTPVLGAAMIMMALDRH* |
Ga0182163_11847341 | 3300015350 | Switchgrass Phyllosphere | MPGLRNRRVLLPFITIALFLTMRMLALITPVLGAAMIMLLMDRH* |
Ga0192916_100037702 | 3300018996 | Marine | MPGLRNRRVLMPFVTVALLLSLRMLVLITPVLAAAMFMVLADRH |
Ga0210306_11917543 | 3300021312 | Estuarine | LLITRRTLAMPGLRNRRVLLPFITIALLLTLRMLAVITPVLGASMFMLLMDRH |
Ga0206689_104924891 | 3300021359 | Seawater | MPGLNNRRFLIPFLTIGILLALRFLALITPVLGGAMIMIFTDRH |
Ga0213848_10952631 | 3300021967 | Watersheds | TNLLITRRTLAMPGLRNRRVLLPFITISILLTLRMLAIITPVLGASMVMLMMDRH |
Ga0256356_10169272 | 3300024546 | Freshwater | MPGMRHRRVLLPFVTIGTLFALRMLAIITPVLGAAMIMMALDRH |
Ga0247601_10006882 | 3300028330 | Seawater | MPGFRNRRALLPFVTISLLLTMRMLAVVTPVLGASMFMLLMDRHWQTTFF |
Ga0257209_10238911 | 3300030587 | Host-Associated | MPGMRHRRILLPFITISILFALRMLAVVTPVLAAAMIMMA |
Ga0314746_10107483 | 3300032758 | Switchgrass Phyllosphere | MPGLRNRRVLLPFITISLFLTMRMLALVTPVLGAAMIMLLLDRH |
Ga0314741_10554551 | 3300032934 | Switchgrass Phyllosphere | RTLSMPGLRNRRVLLPFITIALFLTMRMLALVTPVLGAAMIMLLLDRH |
Ga0334977_0283820_4_138 | 3300033978 | Freshwater | MPGLKNRRILMPFITIAILLTLRMLAIITPVLAAAMIMMALDRH |
Ga0334978_0412194_247_381 | 3300033979 | Freshwater | MPGLRNRRILLPFITIGLFLAMRMLAIITPVLAAAMIMMALDRH |
Ga0334982_0226983_38_172 | 3300033981 | Freshwater | MPGLRHRRILLPFVSIGILLAFRMLALVTPVLAAAMIMMALDRH |
Ga0334982_0514895_381_515 | 3300033981 | Freshwater | MPGFRHRRILLPFVTIGIFLAFRMLAVVTPVLAAAMIMMALDRH |
Ga0334991_0018266_2047_2181 | 3300034013 | Freshwater | MPGLRNRRVLLPFVTIATLLALRLLVPITPVLAAAMIMMALDRH |
Ga0334998_0148707_313_447 | 3300034019 | Freshwater | MPGLKNRRILMPFITIAILLTLRMLAIITPVLAAAMIMMSLDRH |
Ga0310127_001897_5730_5864 | 3300034072 | Fracking Water | MPGLRHRRVLMPFVTISIFLTLRMLATITPVLGAAVIMMAFDRH |
Ga0316598_078836_42_167 | 3300034652 | Untreated Peat Soil | MRHRRVLMPFITISIFLTLRMLATITPVLGAAVIMMAFDRH |
⦗Top⦘ |