NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037200

Metagenome / Metatranscriptome Family F037200

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037200
Family Type Metagenome / Metatranscriptome
Number of Sequences 168
Average Sequence Length 42 residues
Representative Sequence MATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDSGGT
Number of Associated Samples 129
Number of Associated Scaffolds 168

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 99.39 %
% of genes near scaffold ends (potentially truncated) 98.21 %
% of genes from short scaffolds (< 2000 bps) 89.88 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (46.429 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(39.881 % of family members)
Environment Ontology (ENVO) Unclassified
(63.690 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.690 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.35%    β-sheet: 15.94%    Coil/Unstructured: 79.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 168 Family Scaffolds
PF11651P22_CoatProtein 1.79
PF13385Laminin_G_3 1.19
PF06035Peptidase_C93 0.60
PF13884Peptidase_S74 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 168 Family Scaffolds
COG3672Predicted transglutaminase-like proteinPosttranslational modification, protein turnover, chaperones [O] 0.60

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms53.57 %
UnclassifiedrootN/A46.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2222084003|2222363527Not Available510Open in IMG/M
2236876002|none_p009786All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300000101|DelMOSum2010_c10091298All Organisms → Viruses → Predicted Viral1302Open in IMG/M
3300000116|DelMOSpr2010_c10184543Not Available681Open in IMG/M
3300000117|DelMOWin2010_c10153991Not Available755Open in IMG/M
3300001963|GOS2229_1051098All Organisms → Viruses → Predicted Viral1700Open in IMG/M
3300004829|Ga0068515_112338All Organisms → Viruses → Predicted Viral1071Open in IMG/M
3300004941|Ga0068514_1051009Not Available508Open in IMG/M
3300006025|Ga0075474_10068447All Organisms → Viruses → Predicted Viral1176Open in IMG/M
3300006026|Ga0075478_10156373All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300006026|Ga0075478_10197383Not Available615Open in IMG/M
3300006029|Ga0075466_1018559Not Available2277Open in IMG/M
3300006029|Ga0075466_1039035All Organisms → Viruses → Predicted Viral1445Open in IMG/M
3300006637|Ga0075461_10136739All Organisms → Viruses755Open in IMG/M
3300006637|Ga0075461_10201631Not Available595Open in IMG/M
3300006802|Ga0070749_10024292All Organisms → Viruses → Predicted Viral3819Open in IMG/M
3300006802|Ga0070749_10377309Not Available785Open in IMG/M
3300006802|Ga0070749_10460987All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium695Open in IMG/M
3300006810|Ga0070754_10340666All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium665Open in IMG/M
3300006810|Ga0070754_10477462All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300006868|Ga0075481_10020598All Organisms → Viruses → Predicted Viral2606Open in IMG/M
3300006870|Ga0075479_10309037Not Available619Open in IMG/M
3300006916|Ga0070750_10099102All Organisms → Viruses → Predicted Viral1352Open in IMG/M
3300006916|Ga0070750_10215933All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus843Open in IMG/M
3300006916|Ga0070750_10277280All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium722Open in IMG/M
3300006916|Ga0070750_10339143All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300006920|Ga0070748_1240166All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria654Open in IMG/M
3300006925|Ga0098050_1063768Not Available958Open in IMG/M
3300007234|Ga0075460_10210292Not Available659Open in IMG/M
3300007276|Ga0070747_1056664All Organisms → Viruses → Predicted Viral1493Open in IMG/M
3300007276|Ga0070747_1276708Not Available580Open in IMG/M
3300007276|Ga0070747_1304153All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium548Open in IMG/M
3300007344|Ga0070745_1271630All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium609Open in IMG/M
3300007345|Ga0070752_1091588All Organisms → Viruses → Predicted Viral1314Open in IMG/M
3300007345|Ga0070752_1205200All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300007346|Ga0070753_1126351All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus981Open in IMG/M
3300007539|Ga0099849_1238264All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium672Open in IMG/M
3300007540|Ga0099847_1041780All Organisms → Viruses → Predicted Viral1457Open in IMG/M
3300007609|Ga0102945_1051954Not Available798Open in IMG/M
3300007992|Ga0105748_10442708Not Available564Open in IMG/M
3300008050|Ga0098052_1134741Not Available986Open in IMG/M
3300008219|Ga0114905_1191167Not Available664Open in IMG/M
3300009001|Ga0102963_1327104All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium602Open in IMG/M
3300009124|Ga0118687_10196548Not Available734Open in IMG/M
3300009435|Ga0115546_1078779All Organisms → Viruses → Predicted Viral1221Open in IMG/M
3300009508|Ga0115567_10542777Not Available705Open in IMG/M
3300010149|Ga0098049_1068690All Organisms → Viruses → Predicted Viral1121Open in IMG/M
3300010149|Ga0098049_1093317All Organisms → Viruses944Open in IMG/M
3300010297|Ga0129345_1194599All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300010316|Ga0136655_1057664Not Available1205Open in IMG/M
3300010316|Ga0136655_1215105Not Available572Open in IMG/M
3300010318|Ga0136656_1153210Not Available788Open in IMG/M
3300010368|Ga0129324_10047746All Organisms → Viruses → Predicted Viral1968Open in IMG/M
3300010368|Ga0129324_10175447Not Available881Open in IMG/M
3300010368|Ga0129324_10237896All Organisms → cellular organisms → Bacteria → Proteobacteria729Open in IMG/M
3300010368|Ga0129324_10254600Not Available699Open in IMG/M
3300010392|Ga0118731_106191607Not Available702Open in IMG/M
3300011118|Ga0114922_11665044All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter spanius512Open in IMG/M
3300012528|Ga0129352_10629727Not Available2278Open in IMG/M
3300012528|Ga0129352_11013799Not Available615Open in IMG/M
3300017697|Ga0180120_10050035All Organisms → Viruses → Predicted Viral1886Open in IMG/M
3300017719|Ga0181390_1047862All Organisms → Viruses → Predicted Viral1266Open in IMG/M
3300017741|Ga0181421_1137166Not Available633Open in IMG/M
3300017743|Ga0181402_1146797Not Available598Open in IMG/M
3300017746|Ga0181389_1013775All Organisms → Viruses → Predicted Viral2623Open in IMG/M
3300017746|Ga0181389_1070078Not Available996Open in IMG/M
3300017764|Ga0181385_1145911Not Available719Open in IMG/M
3300017770|Ga0187217_1032456All Organisms → Viruses → Predicted Viral1847Open in IMG/M
3300017772|Ga0181430_1208009Not Available557Open in IMG/M
3300017773|Ga0181386_1111862Not Available847Open in IMG/M
3300017786|Ga0181424_10024475All Organisms → Viruses → Predicted Viral2617Open in IMG/M
3300017818|Ga0181565_10730739All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium626Open in IMG/M
3300017824|Ga0181552_10311060Not Available774Open in IMG/M
3300017949|Ga0181584_10232484All Organisms → Viruses → Predicted Viral1201Open in IMG/M
3300017951|Ga0181577_10090937All Organisms → Viruses → Predicted Viral2121Open in IMG/M
3300017951|Ga0181577_10127498All Organisms → Viruses → Predicted Viral1744Open in IMG/M
3300017951|Ga0181577_10383173Not Available897Open in IMG/M
3300017951|Ga0181577_10777531All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium578Open in IMG/M
3300017958|Ga0181582_10192043All Organisms → Viruses → Predicted Viral1396Open in IMG/M
3300017964|Ga0181589_10602791All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium698Open in IMG/M
3300017967|Ga0181590_11132084Not Available503Open in IMG/M
3300017986|Ga0181569_10341188All Organisms → Viruses → Predicted Viral1033Open in IMG/M
3300018039|Ga0181579_10230548All Organisms → Viruses → Predicted Viral1070Open in IMG/M
3300018041|Ga0181601_10240949Not Available1034Open in IMG/M
3300018416|Ga0181553_10490666All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium657Open in IMG/M
3300018417|Ga0181558_10068682All Organisms → Viruses → Predicted Viral2303Open in IMG/M
3300018417|Ga0181558_10691854Not Available520Open in IMG/M
3300018418|Ga0181567_10440482All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter spanius859Open in IMG/M
3300019283|Ga0182058_1466155Not Available709Open in IMG/M
3300019732|Ga0194014_1053355Not Available569Open in IMG/M
3300019740|Ga0193988_1068719Not Available554Open in IMG/M
3300019754|Ga0193956_1098230Not Available565Open in IMG/M
3300019765|Ga0194024_1091109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium rhizogenes693Open in IMG/M
3300020054|Ga0181594_10180114Not Available1079Open in IMG/M
3300020174|Ga0181603_10090769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus1441Open in IMG/M
3300020182|Ga0206129_10327109Not Available605Open in IMG/M
3300020188|Ga0181605_10439027Not Available508Open in IMG/M
3300020194|Ga0181597_10039014All Organisms → Viruses → Predicted Viral3133Open in IMG/M
3300020207|Ga0181570_10424504Not Available631Open in IMG/M
3300020207|Ga0181570_10434116All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes621Open in IMG/M
3300021356|Ga0213858_10236203All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium882Open in IMG/M
3300021368|Ga0213860_10399746All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium595Open in IMG/M
3300021379|Ga0213864_10140861All Organisms → Viruses → Predicted Viral1215Open in IMG/M
3300021379|Ga0213864_10508699All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium602Open in IMG/M
3300021425|Ga0213866_10175374All Organisms → Viruses → Predicted Viral1124Open in IMG/M
3300021958|Ga0222718_10618201Not Available506Open in IMG/M
3300021964|Ga0222719_10530142All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium700Open in IMG/M
3300021964|Ga0222719_10557436Not Available675Open in IMG/M
3300021964|Ga0222719_10745654Not Available546Open in IMG/M
3300022067|Ga0196895_1016681Not Available807Open in IMG/M
3300022067|Ga0196895_1021367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus721Open in IMG/M
3300022067|Ga0196895_1033240Not Available590Open in IMG/M
3300022068|Ga0212021_1134304Not Available506Open in IMG/M
3300022159|Ga0196893_1017199Not Available656Open in IMG/M
3300022159|Ga0196893_1019314Not Available625Open in IMG/M
3300022168|Ga0212027_1034804Not Available661Open in IMG/M
3300022168|Ga0212027_1053257All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium504Open in IMG/M
3300022169|Ga0196903_1031711Not Available624Open in IMG/M
3300022176|Ga0212031_1089703All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium525Open in IMG/M
3300022183|Ga0196891_1080507Not Available577Open in IMG/M
3300022198|Ga0196905_1047274All Organisms → Viruses → Predicted Viral1235Open in IMG/M
3300022200|Ga0196901_1044269Not Available1685Open in IMG/M
3300022934|Ga0255781_10393816Not Available591Open in IMG/M
3300023110|Ga0255743_10101902All Organisms → Viruses → Predicted Viral1708Open in IMG/M
3300023116|Ga0255751_10132861All Organisms → Viruses → Predicted Viral1489Open in IMG/M
3300023176|Ga0255772_10393041Not Available701Open in IMG/M
3300023178|Ga0255759_10149437All Organisms → Viruses → Predicted Viral1591Open in IMG/M
3300023180|Ga0255768_10622832Not Available518Open in IMG/M
(restricted) 3300024264|Ga0233444_10115963All Organisms → Viruses → Predicted Viral1364Open in IMG/M
(restricted) 3300024517|Ga0255049_10510199All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium558Open in IMG/M
3300025085|Ga0208792_1090083All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium540Open in IMG/M
3300025102|Ga0208666_1041882All Organisms → Viruses → Predicted Viral1324Open in IMG/M
3300025543|Ga0208303_1041571All Organisms → Viruses → Predicted Viral1162Open in IMG/M
3300025543|Ga0208303_1099039Not Available619Open in IMG/M
3300025630|Ga0208004_1007543All Organisms → Viruses → Predicted Viral3763Open in IMG/M
3300025652|Ga0208134_1065365All Organisms → Viruses → Predicted Viral1100Open in IMG/M
3300025674|Ga0208162_1072952All Organisms → Viruses → Predicted Viral1081Open in IMG/M
3300025674|Ga0208162_1174044Not Available569Open in IMG/M
3300025751|Ga0208150_1044450All Organisms → Viruses → Predicted Viral1526Open in IMG/M
3300025751|Ga0208150_1233324Not Available560Open in IMG/M
3300025759|Ga0208899_1037470All Organisms → Viruses → Predicted Viral2201Open in IMG/M
3300025759|Ga0208899_1081456All Organisms → Viruses → Predicted Viral1262Open in IMG/M
3300025769|Ga0208767_1110578All Organisms → Viruses → Predicted Viral1077Open in IMG/M
3300025771|Ga0208427_1130802Not Available843Open in IMG/M
3300025803|Ga0208425_1009949All Organisms → Viruses → Predicted Viral2652Open in IMG/M
3300025806|Ga0208545_1152698Not Available550Open in IMG/M
3300025815|Ga0208785_1162284All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium505Open in IMG/M
3300025840|Ga0208917_1136690Not Available864Open in IMG/M
3300025840|Ga0208917_1167243Not Available754Open in IMG/M
3300025880|Ga0209534_10078782All Organisms → Viruses → Predicted Viral1958Open in IMG/M
3300025887|Ga0208544_10198628All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium830Open in IMG/M
3300025887|Ga0208544_10359601Not Available552Open in IMG/M
3300025889|Ga0208644_1030068Not Available3266Open in IMG/M
3300025889|Ga0208644_1030459All Organisms → Viruses → Predicted Viral3238Open in IMG/M
3300026453|Ga0228644_1027571All Organisms → Viruses → Predicted Viral1147Open in IMG/M
3300027159|Ga0208020_1010752All Organisms → Viruses → Predicted Viral1808Open in IMG/M
3300027752|Ga0209192_10078738Not Available1405Open in IMG/M
(restricted) 3300027837|Ga0255041_10081288Not Available1051Open in IMG/M
3300027917|Ga0209536_100621631All Organisms → Viruses → Predicted Viral1344Open in IMG/M
3300028115|Ga0233450_10320834Not Available648Open in IMG/M
3300028125|Ga0256368_1023453Not Available1095Open in IMG/M
3300031519|Ga0307488_10308003All Organisms → Viruses → Predicted Viral1017Open in IMG/M
3300031539|Ga0307380_10486131Not Available1090Open in IMG/M
3300032136|Ga0316201_10231992All Organisms → Viruses → Predicted Viral1602Open in IMG/M
3300033742|Ga0314858_100063Not Available735Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous39.88%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh18.45%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater6.55%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient5.36%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine4.17%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.57%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.38%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.79%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.79%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.19%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine1.19%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.19%
Marine WaterEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water1.19%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.19%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.60%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat0.60%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.60%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.60%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.60%
MarineEnvironmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine0.60%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.60%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.60%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.60%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.60%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.60%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.60%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine0.60%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.60%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.60%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.60%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.60%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2222084003Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - Ctl_5_microcosmEnvironmentalOpen in IMG/M
2236876002Marine microbial communities from Columbia River, CM, sample from CR-7km from mouth, GS312-0p8-CR7-chlmaxEnvironmentalOpen in IMG/M
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001963Marine microbial communities from Nags Head, North Carolina, USA - GS013EnvironmentalOpen in IMG/M
3300004829Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVsEnvironmentalOpen in IMG/M
3300004941Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-0.2umEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007609Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MGEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008219Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05EnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018039Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019732Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MGEnvironmentalOpen in IMG/M
3300019740Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_4-5_MGEnvironmentalOpen in IMG/M
3300019745Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MGEnvironmentalOpen in IMG/M
3300019754Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - BB_7_MGEnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300020054Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020174Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020188Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020194Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020207Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022067Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022159Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300023110Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaGEnvironmentalOpen in IMG/M
3300023116Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaGEnvironmentalOpen in IMG/M
3300023176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaGEnvironmentalOpen in IMG/M
3300023178Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaGEnvironmentalOpen in IMG/M
3300023180Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaGEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024517 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026453Seawater microbial communities from Monterey Bay, California, United States - 56DEnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
22224216172222084003MarineMATTIITKNGSGAPLASDLVAGELAVDLTNGRLYTEDSGGSVIELGLTPSGN
none_00978622236876002Marine EstuarineMTTIITKNGSGAPSAGQLSQGELAVDLTNKQLYSKDLGNNVVKIG
DelMOSum2010_1009129813300000101MarineMATTIVTKYGGDAPAASDIVRGELAVDTENGRLYTENSSGAVV
DelMOSpr2010_1018454313300000116MarineMATTIVTKYGSDAPAASDIVRGELAVDTENGRLYT
DelMOWin2010_1015399133300000117MarineMATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTE
GOS2229_105109833300001963MarineMATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYT
Ga0068515_11233823300004829Marine WaterMTTIKLKNGSGAPLASDLVQGEPALDLTNKRLYTEDSLGA
Ga0068514_105100913300004941Marine WaterMTTIKLKNGSGAPTAGDLAQGEPALDLTNKRLYTEDSGGTVIEV
Ga0075474_1006844713300006025AqueousMATTIKLKNGSGAPLAGDLVAGEPALDLTNKRLYTEDSGG
Ga0075478_1015637333300006026AqueousMATTIKLKNGTGAPSAGALVVAEPALDLTNKRLYTEDSGGTVIEV
Ga0075478_1019738313300006026AqueousMTTIKLKNGSGAPAGGDLTQGEPALDLTNKRLYTENASGTVIEVGTNP
Ga0075466_101855913300006029AqueousMTTIKLKNGSGAPAASDLAQGEPALDLTNKRLYTED
Ga0075466_103903513300006029AqueousMTTIKLKNGSGAPAGGDLVQGEPALDLTNKRLYTEDSG
Ga0075461_1013673913300006637AqueousMATTIITKYGSGAPAASDVVRGELAVDTENKRLYTEDSGGSVVE
Ga0075461_1020163123300006637AqueousMATTIITKYGSGAPTADDLSVGELAVDLTNKRLYSKNSSNAVIEL
Ga0070749_1002429213300006802AqueousMASTIQLKRGSGAPTAGDLAVGEPALDLTNKRLYTEDT
Ga0070749_1037730933300006802AqueousMATRIITKNGSGAPLASDLQQGELAVDLTNKRLYTE
Ga0070749_1046098713300006802AqueousMASTIKLKNGSGAPTTGDLVQGEPALDLTNKRLYTEDSGGTVIEVG
Ga0070749_1057928023300006802AqueousMATTIITKYGSGAPTADDLSVGELAVDLTNKRLYSKNSSNAVIELGVN
Ga0070754_1034066623300006810AqueousMATTIKLKNGSGAPLAGDLVAGEPALDLTNKRLYTED
Ga0070754_1047746213300006810AqueousMATTIKLKNGSGAPTAGDLVTAEPALDLTNKRLYTEDSGGTV
Ga0075481_1002059813300006868AqueousMATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDSGG
Ga0075479_1030903713300006870AqueousMATTIKLKNGSGAPLAGDLVQGEPAFDLTNKRLYTEDSGGTVI
Ga0070750_1009910213300006916AqueousMATTIITKYGSGAPLASDLVRGELAVDTELGRLYTETSGGAVI
Ga0070750_1021593313300006916AqueousMASTIITKYGSGAPLASDLVRGELAVDTELGRLYTETSGGAVI
Ga0070750_1027728023300006916AqueousMATTIKLKNGSGAPLAGDLVAGEPALDLTNKRLYTENSGGTVI
Ga0070750_1033914323300006916AqueousMATTIITKYGSGAPTASDVVRGELAVDTENKRLYTEDSGGSVVELG
Ga0070746_1016783623300006919AqueousMATTIITKNGTGAPLASDLVAGELAVDLTNKRLYTEDSGGTIIEVGSNPSVLDVDNI
Ga0070748_124016633300006920AqueousMTTINLKYGSGEPSTADLVTAEPALDLTNKRLYTENT
Ga0098050_106376813300006925MarineMATTIVTKYGGDAPAASDLVRGELAVDTENGRLYTENAA
Ga0075460_1021029223300007234AqueousMATTIITKNGSGAPTADDLSVGELAVDLTNKRLYSKNSSSEVI
Ga0070747_105666413300007276AqueousMATTIVTKFGSDAPAASDIVRGELAVDTENGRLYTENAAG
Ga0070747_127670823300007276AqueousMATTIVTKYGSDAPAASDLVRGELAVDTENGRLYT
Ga0070747_130415323300007276AqueousMATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTENASGA
Ga0070745_127163013300007344AqueousMATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTENASGTVI
Ga0070752_109158813300007345AqueousMATTIVTKFGSDAPAASDIVRGELAVDTENGRLYTENAAGAVV
Ga0070752_120520013300007345AqueousMTTIITKNGSGAPTAGQLSEGELAVDLTNKELYTKS
Ga0070753_112635123300007346AqueousMATTIITKNGSGAPTADDLSVGELAVDLTNKRLYSKNSS
Ga0099849_123826423300007539AqueousMATTIITKSGSGAPLAGDLQVAELALDLTNKKLYSKEGTTVFEV
Ga0099847_104178013300007540AqueousMATTIVTKNGSGAPTASDLVAGELAVDLTNGRLYTT
Ga0102945_105195413300007609Pond WaterMASRIITKKGSGAPLASDLVHGELAVDTVNKRLYTENAGGTIIEV
Ga0105748_1044270813300007992Estuary WaterMATTIVTKSGSGAPAASDLVAGELAVDLTNGRLYTEDSGGTVLE
Ga0098052_113474123300008050MarineMTTIKLKNGSGAPTSGDLAQGEPALDLTNKRLYTEDSGGNVIEVGTN
Ga0114905_119116713300008219Deep OceanMATTSVTKKGSGAPAASDLVEGELAVDTTNGRLYTEN
Ga0102963_132710423300009001Pond WaterMATTIITKNGSGAPLAGDLTAGELAVDLTNKRLYSKDSGGTVIEL
Ga0118687_1019654823300009124SedimentMTTVIKHKRGSGAPDAADLSEGELALDFTNNAIYTKNASGTV
Ga0115546_107877913300009435Pelagic MarineMATTIVTKSGSGAPTASDLVAGELAVDLTNKRLYTENSGGTVL
Ga0115567_1054277713300009508Pelagic MarineMATTIVTKSGSGAPTASDLVAGELAVDLTNKRLYTEDSGGTVLEL
Ga0098049_106869033300010149MarineMATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTE
Ga0098049_109331733300010149MarineMATTIVTKFGGDAPAASDIVRGELAVDTENGRLYT
Ga0129345_119459933300010297Freshwater To Marine Saline GradientMATTIKLKNGTGAPSAGALVVAEPALDLTNKRLYTEDSGGTVIEVGTN
Ga0136655_105766413300010316Freshwater To Marine Saline GradientMASTIKLKNGTGVPTAGDLVQGEPAFDLTNKRLYTENASGTVIE
Ga0136655_121510523300010316Freshwater To Marine Saline GradientMTTTIKLKNGSGVPTAGDLVQGEPAFDLTNKRLYTENASGT
Ga0136656_115321013300010318Freshwater To Marine Saline GradientMATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTENASGTVIEVGTNPTS
Ga0129324_1004774613300010368Freshwater To Marine Saline GradientMATTIKLKNGSGAPLAGDLVQGEPAFDLTNKRLYTEDSGGT
Ga0129324_1017544723300010368Freshwater To Marine Saline GradientMATTIKLKNGSGAPTAGDLVQGEPAFDLTNKRLYT
Ga0129324_1023789633300010368Freshwater To Marine Saline GradientMATTIVTKNGSGAPTASDLVAGELAVDLTNKRLYTEDSGGTVLELGT
Ga0129324_1025460023300010368Freshwater To Marine Saline GradientMTTTIKLKNGSGVPTAGDLVQGEPAFDLTNKRLYTENA
Ga0118731_10619160723300010392MarineMTTIKLKNGSGAPAASDLVQGEPAFDLTNKRLYTEN
Ga0114922_1166504413300011118Deep SubsurfaceMATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDSGGSVIE
Ga0129352_1062972743300012528AqueousMAIKLKTGSGAPLPTDLIEGEPALDLTNKRLYSETGGVVFEVGTNPSEFTLA
Ga0129352_1101379923300012528AqueousMATTIVTKNGSGAPTDSDLVAGELAVDLTNGRLYTTDLD
Ga0180120_1005003533300017697Freshwater To Marine Saline GradientMTTIKLKNGSGAPAASDLVQGEPALDLTNKRLYTENASGTV
Ga0181390_104786213300017719SeawaterMTTIKLKNGSGAPAGGDLVQGEPALDLTNKRLYTENASGTA
Ga0181421_113716613300017741SeawaterMATTIVTKSGSGAPAASDLVAGELAVDLTNKRLYTEDSSAAIIELG
Ga0181402_114679723300017743SeawaterMATTIVTKSGSGAPAASDLVAGELAVDLTNKRLYMEDGSAA
Ga0181389_101377543300017746SeawaterMATTIVTKYGSDAPAASDIVRGELAVDTENGRLYTENSSAAVI
Ga0181389_107007823300017746SeawaterMTTIKLKNGSGAPAGGDLVQGEPALDLTNKRLYTENASGTVPPSP
Ga0181385_114591113300017764SeawaterMATTIKLKNGSGAPATSDLVQGEPAIDLTNRRLYTENAS
Ga0187217_103245613300017770SeawaterMTTIKLKNGSGAPTAGDLAQGEPALDLTNKRLYTEDSG
Ga0181430_120800913300017772SeawaterMATTIKLKNGSGAPAASSLLHAVPAFDLTNKRLYTEDANGAVIEVGSNPTALTLSNWTIQEVSNNLLFSYNG
Ga0181386_111186213300017773SeawaterMATTIVTKYGSDAPAASDIVRGELAVDTENGRLYTENAAGAVVE
Ga0181424_1002447513300017786SeawaterMTTIKLKNGSGAPATSDLVQGEPALDLTNKRLYTENASGAVI
Ga0181565_1073073913300017818Salt MarshMATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDS
Ga0181552_1031106013300017824Salt MarshMASTIKLKNGSGAPLASDLVAGEPALDLTNKRLYTEDSGGTVIEVGTN
Ga0181584_1023248413300017949Salt MarshMATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDSGGTVIEV
Ga0181577_1009093713300017951Salt MarshMATTIVTKNGSGAPTASHLVAGELAVDLTNGRLYTE
Ga0181577_1012749833300017951Salt MarshMPSTIITKNGSGAPLAADLVAGELAVDLTNGRLYTEDSG
Ga0181577_1038317323300017951Salt MarshMATTIITKFGSGAPTADDVVRGELAVDTENKRLYTEDSGGSVV
Ga0181577_1077753113300017951Salt MarshMATTIITKYGSGAPTTSDVVRGELAVDTENGRLYTLNSSNTV
Ga0181582_1019204323300017958Salt MarshMATTIITKYGSGAPTTSDVVRGELAVDTENGRLYTLNSS
Ga0181589_1060279123300017964Salt MarshMATTIITKYGSGAPTTSDVIRGELAVDTENGRLYTLNSSNAVVE
Ga0181590_1113208423300017967Salt MarshMASTIKLKNGSGAPLASDLVAGEPALDLTNKRLYTEDSGGTVIEVGTNPTEIQIDNINIDGN
Ga0181569_1034118813300017986Salt MarshMPSTIITKNGSGAPLAADLVAGELAVDLTNGRLYTEDSGGSVI
Ga0181579_1023054813300018039Salt MarshMATTIITKFGSGAPAASDVVRGELAVDTENGRLYTENIAGS
Ga0181601_1024094913300018041Salt MarshMATTIVTKNGSGAPTASDLVAGELAVDLTNGRLYTTDLDSGGT
Ga0181553_1049066623300018416Salt MarshMATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDSGGTVI
Ga0181558_1006868233300018417Salt MarshMATTIKLKNGSGAPLAGDLVQGEPAFDLTNKRLYTE
Ga0181558_1069185413300018417Salt MarshMASTIKLKNGSGAPLASDLVAGEPALDLTNKRLYTEDSGGTVIEV
Ga0181567_1044048213300018418Salt MarshMATTIKLKNGSGAPSAASLVQGEPAFDLTNKRLYTEDSGGTVIEV
Ga0182058_146615523300019283Salt MarshMATTIKLKNGSGAPLAGDLVQGEPAFDLTNKRLYTED
Ga0194014_105335523300019732SedimentMATTIVTKYGSDAPAASDLVRGELAVDTENGRLYTENAAGAV
Ga0193988_106871913300019740SedimentMATTIITKNGSGAPTTDDLSTGELAIDLTNKRLYS
Ga0194002_103511113300019745SedimentMATTIVTKNGSGAPTASDLVAGELAVDLTNGRLYTTDLDSGGTVLELGTNP
Ga0193956_109823013300019754Freshwater Microbial MatMATTIVTKNGSGAPTASDLVAGELAVDLTNGRLYTENSGGT
Ga0194024_109110913300019765FreshwaterMATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTEDSGGTVIEVGTNP
Ga0181594_1018011433300020054Salt MarshMATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTEDSGGTVIEVGTNPSTI
Ga0181603_1009076913300020174Salt MarshMATTIVTKNGTGAPTDSDLVAGELAVDLTNGRLYTTDLDSGGTV
Ga0206129_1032710913300020182SeawaterMATTIVTKSGSGAPTASDLVAGELAVDLTNKRLYTEDSGGTVLE
Ga0181605_1043902713300020188Salt MarshMATTIVTKNGTGAPTDSDLVAGELAVDLTNGRLYTTDL
Ga0181597_1003901443300020194Salt MarshMATTIITKNGSGAPLAGDLQVGELAIDLTNKKLYSKEGTTV
Ga0181570_1042450423300020207Salt MarshMATTIKLKNGSGAPLASDLVQGEPALDLTNKRLYSEDSGGTV
Ga0181570_1043411613300020207Salt MarshMPSTIITKNGSGAPLAADLVAGELAVDLTNGRLYTEDSGGSVIEIGLKPSGKV
Ga0213858_1023620323300021356SeawaterMATTIITKFGSGAPTASDVVRGELAVDTENKRLYTEDSGG
Ga0213860_1039974623300021368SeawaterMTTIKLKNGSGAPTAGDLVQGEPALDLTNKRLYTEDSGGTVI
Ga0213864_1014086133300021379SeawaterMATTIKLKNGSGAPLAGDLVQGEPAFDLTNKRLYTEDSG
Ga0213864_1050869923300021379SeawaterMATTIKLKNGSGAPLAGDLVAGEPALDLTNKRLYTEDSGGTVIEVGT
Ga0213866_1017537413300021425SeawaterMATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYT
Ga0222718_1061820123300021958Estuarine WaterMATTLVTKNGSGAPASSDLISGELAVDLTNKRLYS
Ga0222719_1053014213300021964Estuarine WaterMATTIITKNGSGAPLAGDLTAGELAVDLTNKRLYSKDSGGTVIELGTTPSS
Ga0222719_1055743633300021964Estuarine WaterMATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTEDSGGTVIEVGT
Ga0222719_1074565413300021964Estuarine WaterMATTIKLKNGSGAPLASDLVQGEPAFDLTNKRLYTE
Ga0196895_101668133300022067AqueousMATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTEDSGGTVIEVGTK
Ga0196895_102136723300022067AqueousMATTIVTKNGTGAPTASDLVAGELAVDLTNGRLYTTDLDSGGTVLELGTN
Ga0196895_103324013300022067AqueousMATTIKLKNGSGAPTAGDLVQGEPAFDLTNKRLYTEDSGGT
Ga0212021_113430413300022068AqueousMATTIKLKNGSGAPAASSLVQGEPAFDLTNKRLYTEDSGGTVIEIGSNPTALTLGNWT
Ga0196893_101719923300022159AqueousMTTIKLKNGSGAPTAGDLVQGEPALDLTNKRLYTENA
Ga0196893_101931423300022159AqueousMATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTEDSGGT
Ga0212027_103480413300022168AqueousMATTIVTKSGSGAPTASDLVAGELAVDLTNKRLYTEDSGGT
Ga0212027_105325713300022168AqueousMTTIKLKNGSGAPTAGDLVTAEPALDLTNKRLYTEDSGGTVIE
Ga0196903_103171123300022169AqueousMASTIKLKNGSGAPTTGDLVQGEPALDLTNKRLYTE
Ga0212031_108970323300022176AqueousMATTIITKNGSGAPLAGDLTAGELAVDLTNKRLYSKDSGGTV
Ga0196891_108050713300022183AqueousMATTIITKYGSGAPTADDLSVGELAVDLTNKRLYSKN
Ga0196905_104727413300022198AqueousMASTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTENASGV
Ga0196901_104426913300022200AqueousMATTIKLKNGTGVPLVGDLVQGEPAFDLTNKRLYTENAGGTVI
Ga0255781_1039381613300022934Salt MarshVATTIKLKTGSGAPLNTDLVQGEPAIDLTNKRLYT
Ga0255743_1010190233300023110Salt MarshMPSTIITKNGSGAPLAADLVAGELAVDLTNGRLYTEDSGG
Ga0255751_1013286113300023116Salt MarshMATTIKLKNGSGAPLAGDLVQGEPAFDLTNKRLYTEDSGGTVIEVG
Ga0255772_1039304133300023176Salt MarshMATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTEDSGGTVIEVGTNPT
Ga0255759_1014943713300023178Salt MarshMATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTED
Ga0255768_1062283213300023180Salt MarshMATTIITKYGSGAPTADDLSIGELAVDLTNKRLYSKNSSSEVIELG
(restricted) Ga0233444_1011596313300024264SeawaterMATTIITKNGSGAPAAGDLVQGELAVDLTNQTLYSKDSSGNVFKVG
(restricted) Ga0255049_1051019923300024517SeawaterMATKIITKTGSGAPTTSDVDRGELAVDLTNKQLYTNDGXRT
Ga0208792_109008323300025085MarineMTTIKLKNGSGAPTSGDLAQGEPALDLTNKRLYTEDSGGNVIE
Ga0208666_104188223300025102MarineMTTIKLKNGSGAPAGGDLVQGEPALDLTNKRLYTENASG
Ga0208303_104157143300025543AqueousMASTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYT
Ga0208303_109903923300025543AqueousMTTTIKLKNGTGVPTAGALVQGEPAFDLTNKRLYTENAG
Ga0208004_100754313300025630AqueousMASTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDSGGNVI
Ga0208134_106536513300025652AqueousMTTIKLKNGSGAPTAGDLVQGEPALDLTNKRLYTEDSGGTVIEV
Ga0208162_107295233300025674AqueousMATTIKLKSGSGAPLAGDLVAAEPAFDLTNKRLYTEDSGGTVIE
Ga0208162_117404413300025674AqueousMASTIKLKNGSGAPLDSDLVAGEPALDLTNKRLYTEDSGGTVIE
Ga0208150_104445023300025751AqueousMASTIKLKNGSGAPLASDLVAGEPALDLTNKRLYTEDSGGTVIEVGTNP
Ga0208150_123332413300025751AqueousMATTIVTKNGTGAPTDSDLVAGELAVDLTNGRLYTT
Ga0208899_103747043300025759AqueousMPSTIITKNGSGAPLAADLVAGELAVDLTNGRLYT
Ga0208899_108145623300025759AqueousMTTIKLKNGSGAPAGGDLVQGEPALDLTNKRLYTEDSGGTVIEVGT
Ga0208767_111057823300025769AqueousMATTIITKYGSGAPLASDLVRGELAVDTELGRLYTETSG
Ga0208427_113080223300025771AqueousMATTIKLKNGSGAPTAGDLVQGEPAFDLTNKRLYTE
Ga0208425_100994943300025803AqueousMATTIITKNGSGAPTTDDLSTGELAIDLTNKRLYSY
Ga0208545_115269813300025806AqueousMATTIVTKFGSDAPAASDIVRGELAVDTENGRLYTENAAGAVVEL
Ga0208785_116228423300025815AqueousMATTIKLKNGSGAPLAGDLVQGEPALDLTNKRLYTEDSGGT
Ga0208917_113669023300025840AqueousMATTIVTKSGSGAPTASDLVAGELAVDLTNKRLYT
Ga0208917_116724313300025840AqueousMASTIKLKNGSGAPLASDLVAGEPALDLTNKRLYTEDSG
Ga0209534_1007878213300025880Pelagic MarineMATKIVTKSGSGAPTTDDLIAGELAVDLTNGRLYT
Ga0208544_1019862823300025887AqueousMTTIKLKNGSGAPATSDLVQGEPALDLTNKRLYTENASGAII
Ga0208544_1035960123300025887AqueousMATTIVTKYGSDAPATTDIVRGELAVDTENGRLYTENAA
Ga0208644_103006843300025889AqueousMASTIQLKRGSGAPTAGDLAVGEPALDLTNKRLYTEDTGG
Ga0208644_103045973300025889AqueousMATTIITKYGSGAPLASDLVRGELAVDTELGRLYTET
Ga0228644_102757123300026453SeawaterMSATTIITKNGSGAPAAGDLVQGELAVDLTNQTLYSKDSSGNVFK
Ga0208020_101075213300027159EstuarineMATTIVTKSGSGAPAASDLVAGELAVDLTNGRLYTEDSGGT
Ga0209192_1007873813300027752MarineMASTIKLKRGSGEPGAGALVEGEPAFDLTNKRLYTENSGGTVLEIGTNPT
(restricted) Ga0255041_1008128823300027837SeawaterMTTIITKNGSGAPTAGQLSEGELAVDLTNKELYTKSGSTVIKIGGTGG
Ga0209536_10062163113300027917Marine SedimentMPSTIITKNGSGAPLAADLVAGELAVDLTNGRLYTDDGSSVIEIGLNPS
Ga0233450_1032083413300028115Salt MarshMATTIKLKNGSGAPLASDLVQGEPAFDLTNKRLYTEDS
Ga0256368_102345323300028125Sea-Ice BrineMATKIVTKSGSGAPATTDLVAGELAVDLTNKRLYTENGSAAIIV
Ga0307488_1030800313300031519Sackhole BrineMATKIVTKSGSGAPATTDLVAGELAVDLTNKRLYTENGSAA
Ga0307380_1048613113300031539SoilMTTIKLKNGSGAPDAADLVQGEVALDLTNKRIYSENASGTVIE
Ga0316201_1023199223300032136Worm BurrowMATTIKLKNGSGAPLAGDLVAGEPALDLTNKRLYTEDSGGTVIEVGTNP
Ga0314858_100063_1_1353300033742Sea-Ice BrineMATTIVTKSGSGAPTASDLVAGELAVDLTNGRLYTEDSGGTVLEL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.