Basic Information | |
---|---|
Family ID | F039084 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 164 |
Average Sequence Length | 43 residues |
Representative Sequence | TADGRVIEPSKIRKDSKVRVHYLKSGDDMLVDKVIVTDRD |
Number of Associated Samples | 142 |
Number of Associated Scaffolds | 164 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.66 % |
% of genes near scaffold ends (potentially truncated) | 89.02 % |
% of genes from short scaffolds (< 2000 bps) | 90.85 % |
Associated GOLD sequencing projects | 134 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.293 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.341 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.707 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.073 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 27.94% Coil/Unstructured: 67.65% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 164 Family Scaffolds |
---|---|---|
PF00583 | Acetyltransf_1 | 5.49 |
PF00011 | HSP20 | 4.27 |
PF01594 | AI-2E_transport | 3.66 |
PF03486 | HI0933_like | 1.83 |
PF03466 | LysR_substrate | 1.83 |
PF12833 | HTH_18 | 1.83 |
PF05532 | CsbD | 1.22 |
PF09828 | Chrome_Resist | 1.22 |
PF00575 | S1 | 1.22 |
PF00072 | Response_reg | 0.61 |
PF05016 | ParE_toxin | 0.61 |
PF12680 | SnoaL_2 | 0.61 |
PF10129 | OpgC_C | 0.61 |
PF08755 | YccV-like | 0.61 |
PF00764 | Arginosuc_synth | 0.61 |
PF04191 | PEMT | 0.61 |
PF01740 | STAS | 0.61 |
PF01936 | NYN | 0.61 |
PF04140 | ICMT | 0.61 |
PF07332 | Phage_holin_3_6 | 0.61 |
PF13650 | Asp_protease_2 | 0.61 |
PF07589 | PEP-CTERM | 0.61 |
PF06745 | ATPase | 0.61 |
PF10114 | PocR | 0.61 |
PF12836 | HHH_3 | 0.61 |
PF02518 | HATPase_c | 0.61 |
PF02687 | FtsX | 0.61 |
PF00291 | PALP | 0.61 |
PF00300 | His_Phos_1 | 0.61 |
COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
---|---|---|---|
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 4.27 |
COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 3.66 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 3.66 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 3.66 |
COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 1.83 |
COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 1.83 |
COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 1.83 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.83 |
COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 1.83 |
COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 1.83 |
COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 1.83 |
COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 1.83 |
COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 1.83 |
COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 1.83 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 1.22 |
COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.61 |
COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.61 |
COG3785 | Heat shock protein HspQ | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.29 % |
Unclassified | root | N/A | 6.71 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_17242336 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1069 | Open in IMG/M |
2088090014|GPIPI_17411813 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1408 | Open in IMG/M |
2166559005|cont_contig41332 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 937 | Open in IMG/M |
2170459005|F1BAP7Q02IOU70 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
2170459007|GJ61VE201EEIIG | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
2170459009|GA8DASG02I83WQ | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
2170459012|GOYVCMS02F4UT2 | Not Available | 504 | Open in IMG/M |
2228664022|INPgaii200_c1159560 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105037693 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 753 | Open in IMG/M |
3300000550|F24TB_10642640 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300000955|JGI1027J12803_100307560 | Not Available | 532 | Open in IMG/M |
3300000955|JGI1027J12803_102969078 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300002899|JGIcombinedJ43975_10106557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca | 517 | Open in IMG/M |
3300004157|Ga0062590_102929792 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300004480|Ga0062592_102441463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca | 525 | Open in IMG/M |
3300005178|Ga0066688_10060737 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2215 | Open in IMG/M |
3300005179|Ga0066684_10176113 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
3300005294|Ga0065705_10505694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca | 768 | Open in IMG/M |
3300005294|Ga0065705_11064926 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300005329|Ga0070683_101127428 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 754 | Open in IMG/M |
3300005347|Ga0070668_101715187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca | 577 | Open in IMG/M |
3300005364|Ga0070673_102233246 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300005445|Ga0070708_100778495 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300005445|Ga0070708_100869887 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300005456|Ga0070678_100689299 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300005468|Ga0070707_100980175 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300005471|Ga0070698_100176683 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2075 | Open in IMG/M |
3300005536|Ga0070697_100222874 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
3300005546|Ga0070696_100444855 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1021 | Open in IMG/M |
3300005559|Ga0066700_10345181 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300005559|Ga0066700_11107523 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300005569|Ga0066705_10300299 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1018 | Open in IMG/M |
3300005575|Ga0066702_10278923 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1020 | Open in IMG/M |
3300005598|Ga0066706_10464443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1008 | Open in IMG/M |
3300006028|Ga0070717_11366148 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300006028|Ga0070717_11550814 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300006034|Ga0066656_10495639 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300006755|Ga0079222_10032971 | All Organisms → cellular organisms → Bacteria | 2235 | Open in IMG/M |
3300006797|Ga0066659_11189809 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300006903|Ga0075426_10968701 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 643 | Open in IMG/M |
3300006954|Ga0079219_12354443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales | 516 | Open in IMG/M |
3300007255|Ga0099791_10640664 | Not Available | 521 | Open in IMG/M |
3300009098|Ga0105245_13256334 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300009148|Ga0105243_11809977 | Not Available | 642 | Open in IMG/M |
3300009174|Ga0105241_12012732 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300010048|Ga0126373_10116269 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2496 | Open in IMG/M |
3300010303|Ga0134082_10473927 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 543 | Open in IMG/M |
3300010360|Ga0126372_10549940 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1096 | Open in IMG/M |
3300010371|Ga0134125_10383237 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1560 | Open in IMG/M |
3300010397|Ga0134124_12526649 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300010399|Ga0134127_11771666 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 693 | Open in IMG/M |
3300011119|Ga0105246_12086285 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300012011|Ga0120152_1017057 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 2847 | Open in IMG/M |
3300012205|Ga0137362_10165437 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1897 | Open in IMG/M |
3300012212|Ga0150985_112163604 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300012361|Ga0137360_10044867 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3154 | Open in IMG/M |
3300012361|Ga0137360_11285503 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300012362|Ga0137361_11555922 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300012362|Ga0137361_11718303 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300012469|Ga0150984_118283519 | Not Available | 832 | Open in IMG/M |
3300012685|Ga0137397_10399621 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1023 | Open in IMG/M |
3300012897|Ga0157285_10016144 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
3300012910|Ga0157308_10249696 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 625 | Open in IMG/M |
3300012917|Ga0137395_10774208 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300012918|Ga0137396_10818795 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300012923|Ga0137359_11710286 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300012957|Ga0164303_10913421 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300012958|Ga0164299_10477446 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300012958|Ga0164299_11282857 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300012961|Ga0164302_10268419 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300012961|Ga0164302_10567692 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 816 | Open in IMG/M |
3300012961|Ga0164302_10747073 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300012989|Ga0164305_11740415 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 561 | Open in IMG/M |
3300013096|Ga0157307_1136298 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300013297|Ga0157378_13194840 | Not Available | 509 | Open in IMG/M |
3300013307|Ga0157372_12179491 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300014058|Ga0120149_1014854 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
3300014325|Ga0163163_12627735 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300014745|Ga0157377_10867062 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300014968|Ga0157379_12516956 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 515 | Open in IMG/M |
3300014969|Ga0157376_10418014 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
3300015264|Ga0137403_10841042 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300015371|Ga0132258_10432684 | All Organisms → cellular organisms → Bacteria | 3277 | Open in IMG/M |
3300015371|Ga0132258_12695166 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1240 | Open in IMG/M |
3300015372|Ga0132256_100362271 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1546 | Open in IMG/M |
3300015372|Ga0132256_100973242 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 964 | Open in IMG/M |
3300015374|Ga0132255_103614349 | Not Available | 658 | Open in IMG/M |
3300015374|Ga0132255_104797771 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300016319|Ga0182033_11366360 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 637 | Open in IMG/M |
3300018000|Ga0184604_10106397 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 876 | Open in IMG/M |
3300018028|Ga0184608_10384932 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300018433|Ga0066667_11108750 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300019361|Ga0173482_10125927 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 966 | Open in IMG/M |
3300019881|Ga0193707_1109196 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300019886|Ga0193727_1163626 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300019887|Ga0193729_1016446 | All Organisms → cellular organisms → Bacteria | 3251 | Open in IMG/M |
3300019887|Ga0193729_1027190 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
3300019887|Ga0193729_1136853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 897 | Open in IMG/M |
3300019890|Ga0193728_1068349 | Not Available | 1694 | Open in IMG/M |
3300020001|Ga0193731_1007222 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2827 | Open in IMG/M |
3300020006|Ga0193735_1167260 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300020012|Ga0193732_1069218 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300020018|Ga0193721_1057264 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1021 | Open in IMG/M |
3300020059|Ga0193745_1089525 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 663 | Open in IMG/M |
3300021171|Ga0210405_10002185 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 20649 | Open in IMG/M |
3300021344|Ga0193719_10062616 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
3300021344|Ga0193719_10219700 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300021344|Ga0193719_10367774 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300021413|Ga0193750_1080930 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300021418|Ga0193695_1017116 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1502 | Open in IMG/M |
3300021432|Ga0210384_10298263 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
3300021478|Ga0210402_10508487 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300022534|Ga0224452_1063292 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1109 | Open in IMG/M |
3300022694|Ga0222623_10061417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1450 | Open in IMG/M |
3300023058|Ga0193714_1029479 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300024181|Ga0247693_1061795 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300025271|Ga0207666_1056680 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 625 | Open in IMG/M |
3300025290|Ga0207673_1052499 | Not Available | 578 | Open in IMG/M |
3300025898|Ga0207692_10672841 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300025910|Ga0207684_10362478 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300025915|Ga0207693_10901847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
3300025921|Ga0207652_11169849 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 670 | Open in IMG/M |
3300025922|Ga0207646_11626804 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300025926|Ga0207659_11208496 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300025933|Ga0207706_11633012 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300025939|Ga0207665_10000279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 35535 | Open in IMG/M |
3300025960|Ga0207651_11699028 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 568 | Open in IMG/M |
3300025972|Ga0207668_10997143 | Not Available | 748 | Open in IMG/M |
3300026089|Ga0207648_10285171 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
3300026328|Ga0209802_1040061 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
3300026334|Ga0209377_1036600 | All Organisms → cellular organisms → Bacteria | 2296 | Open in IMG/M |
3300026374|Ga0257146_1067728 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300026498|Ga0257156_1132287 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300026515|Ga0257158_1108463 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 552 | Open in IMG/M |
3300026542|Ga0209805_1068234 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1736 | Open in IMG/M |
3300026552|Ga0209577_10446929 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300026664|Ga0207558_101577 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300026684|Ga0207556_100812 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300026693|Ga0208709_105487 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300027018|Ga0208475_1000649 | All Organisms → cellular organisms → Bacteria | 2917 | Open in IMG/M |
3300027610|Ga0209528_1022768 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1379 | Open in IMG/M |
3300027727|Ga0209328_10198907 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300028715|Ga0307313_10296473 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300028716|Ga0307311_10233919 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300028793|Ga0307299_10197531 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 757 | Open in IMG/M |
3300028811|Ga0307292_10224131 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 777 | Open in IMG/M |
3300028824|Ga0307310_10179787 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 990 | Open in IMG/M |
3300028884|Ga0307308_10210147 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 932 | Open in IMG/M |
3300031093|Ga0308197_10419418 | Not Available | 529 | Open in IMG/M |
3300031231|Ga0170824_117674063 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300031446|Ga0170820_10499824 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1115 | Open in IMG/M |
3300031469|Ga0170819_16508572 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 598 | Open in IMG/M |
3300031469|Ga0170819_17234467 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300031740|Ga0307468_100911765 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 763 | Open in IMG/M |
3300031754|Ga0307475_10741390 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 782 | Open in IMG/M |
3300031754|Ga0307475_10816471 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300031820|Ga0307473_10234058 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1115 | Open in IMG/M |
3300031820|Ga0307473_11559565 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
3300031823|Ga0307478_11083743 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 669 | Open in IMG/M |
3300031833|Ga0310917_11173236 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300031847|Ga0310907_10736518 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 548 | Open in IMG/M |
3300032180|Ga0307471_101621859 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300032180|Ga0307471_103962930 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300032205|Ga0307472_102433048 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.93% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.71% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.44% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 2.44% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.44% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.44% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.83% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.22% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.22% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.22% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.22% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.22% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.22% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.22% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.22% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.61% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.61% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.61% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.61% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.61% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.61% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026664 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-C (SPAdes) | Environmental | Open in IMG/M |
3300026684 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK08-E (SPAdes) | Environmental | Open in IMG/M |
3300026693 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN595 (SPAdes) | Environmental | Open in IMG/M |
3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_03889640 | 2088090014 | Soil | YVTSDGRVIEASKVRKDSKVRVHYVREGDEMIVDKVIVTDTRD |
GPIPI_01603130 | 2088090014 | Soil | SDGRVIQPSEIRKDSKVQVHYVKDGDDMLVDKVIVTKTRY |
cont_0332.00003120 | 2166559005 | Simulated | TVTYQTADGRVIEPSQIRKDSKVRVHYLKSGDDMLVDKVIVTDRD |
E41_10423670 | 2170459005 | Grass Soil | LEILQILVTADGKVIEASKIRKDSKVRVHYVKDGAEMMVDKVIVTQDRD |
L02_03294060 | 2170459007 | Grass Soil | FVTSDGRVIEASKIRKDSKVRVHYIKDGDNMVVDKVIVTKVRD |
F47_02232370 | 2170459009 | Grass Soil | RYKFSKTVTYQTADGRVIEPSQIRKDSKVRVHYLKSGDDMLVDKVIVTDRD |
N56_05407100 | 2170459012 | Grass Soil | YKFSKQVTYVTSDGRVISTFTNTEKNSKVQVHYVKSGDDMLVDKVIVTKTRY |
INPgaii200_11595601 | 2228664022 | Soil | KQVTYVTANGRVIDASKIRKDSKVQVHYVKDGDDMLIDKVIVTNDRD |
INPhiseqgaiiFebDRAFT_1050376932 | 3300000364 | Soil | NAHGKVIEASKIRKDSKVQVHYLKDGDDMVIDKVIVTPSRD* |
F24TB_106426401 | 3300000550 | Soil | VIEASKIRKDSKVRVHYIKQGDDMLVDKVIVSDRD* |
JGI1027J12803_1003075601 | 3300000955 | Soil | IEASKVRKDSKVRVHYVREGDEMIVDKVIVTDTRD* |
JGI1027J12803_1029690781 | 3300000955 | Soil | IEASKIRKDSKVRVHYVKDGDDMLVDKVIVTKDRD* |
JGIcombinedJ43975_101065571 | 3300002899 | Soil | VTADGRVIDASKIRKDSKVQVHYVKDGDDMLIDKVIVTKDRD* |
Ga0062590_1029297921 | 3300004157 | Soil | TYVTSDGRVIEASKIRKDSKVRVHYIKDGDNMVVDKVIVTKVRD* |
Ga0062592_1024414631 | 3300004480 | Soil | TYVTSDGRVIEASKIRKDSKVRVHYIKDGDNMVIDKVIVTKVRD* |
Ga0066688_100607375 | 3300005178 | Soil | QTADGRVIEPSKIRKDSKVRVHYLKSGDDMLVDKVIVTHRD* |
Ga0066684_101761131 | 3300005179 | Soil | TYVNANGRVIDASKIRKDSKVQVHYVKDGDDMMVDKVIVTKDRD* |
Ga0065705_105056941 | 3300005294 | Switchgrass Rhizosphere | FGKTVTYVTSDGRVIEASKIRKDSKVRVHYIKDGDNMVVDKVIVTKVRD* |
Ga0065705_110649261 | 3300005294 | Switchgrass Rhizosphere | VTYVTADGRVIDASKIRKDSKVQVHYVKDGDDMLIDKVIVTKDRD* |
Ga0070683_1011274281 | 3300005329 | Corn Rhizosphere | GKQVTYVTSDGRVIQPSEVRKDSKVRVHYVKEGDDMLVDKVIVTKTRY* |
Ga0070668_1017151871 | 3300005347 | Switchgrass Rhizosphere | KQVTYVTSDGRVIQPSEVRKDSKVRVHYVKEGDDMLVDKVIVTKTRY* |
Ga0070673_1022332462 | 3300005364 | Switchgrass Rhizosphere | GKTVTYVTSDGKVIEASKIRKDSKVHLHYIKDGDDMLVDKVIVTDVRD* |
Ga0070708_1007784952 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | YVNAHGKVIEASKIKRDSKVRVHYLKHGNDMVVDKVILTPNRH* |
Ga0070708_1008698872 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VRYKFHKKVIYMTSDGKVIEASKIRKDSKVRVHYLKDGDDMVVDKVIVTQDRD* |
Ga0070678_1006892991 | 3300005456 | Miscanthus Rhizosphere | KFSKQVTYVTSDGRVIEASKIRKDSKVHVHYVKVGDDMVVDKVIVTKNSD* |
Ga0070707_1009801751 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSDGKVIEASKIRKDSKVRVHYIKQGDDMLVDKVIVTEARD* |
Ga0070698_1001766834 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | FKFGKTVEFVNAHGKVIETSKITRDSKVRVHFVKQGDDMLVDKVILTPDRH* |
Ga0070697_1002228744 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VTYVTPDGKVIDASRIKKNSKVRVHYIKEGNDMLVDKVIVTDTD* |
Ga0070696_1004448552 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | FSKTVTYQTADGRVIEPSQIRKDSKVRVHYLKSGDDMLVDKVIVTDRD* |
Ga0066700_103451812 | 3300005559 | Soil | VRYKFDKTVTCMTSDAKVIEASKIRKDSKVRVHYIKNDDDMLVDKVIVTQDRD* |
Ga0066700_111075232 | 3300005559 | Soil | DGRVIEPSKIRKDSKVRVHYLKSGDDMLVDKVIVTDRD* |
Ga0066705_103002993 | 3300005569 | Soil | DGRVIEPSKIRKDSKVRVHYLKSGDDMLVDKVIVTHRD* |
Ga0066702_102789231 | 3300005575 | Soil | KFNKTVTYQTADGRVIEASKIRKDSKVRVHYIKSGDDMLVDKVIVTDRD* |
Ga0066706_104644433 | 3300005598 | Soil | QTADGRVIEPSKIRKDSKVRVHYLKSGDDVLVDKVIVTDRD* |
Ga0070717_113661481 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | YKFSKQVTYVTSDGRVIEPSKIRKDSKVQVHYVKDGDDMLIDKVIVTKNRY* |
Ga0070717_115508142 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IEASKIRKDSKVRVHYIKDGNDMVVDKVIVTRNRY* |
Ga0066656_104956392 | 3300006034 | Soil | TYVNAHGKVIQPSKIRTDSKVRVHWVKQGDDMLVDKVILTPDRH* |
Ga0079222_100329714 | 3300006755 | Agricultural Soil | VIDASKIRKDSKVQVHYVKDGDDMMIDKVIVTKDRD* |
Ga0066659_111898093 | 3300006797 | Soil | VIEPSKIRKDSKVRVHYMKSGDDMLVDKVIVTDRD* |
Ga0075426_109687012 | 3300006903 | Populus Rhizosphere | IEPSKIRKDSKVRVHYLKSGDDMLVDKVIVTDRD* |
Ga0079219_123544432 | 3300006954 | Agricultural Soil | VTYVTSDGKVIEASKVTKDSKVRVHYIKDGDEMLVDKVIVTQDRN* |
Ga0099791_106406641 | 3300007255 | Vadose Zone Soil | KFGKTVEFVNAHGKVIEASKIRKDSKVHVHYVRHGDDMVVDKVTLTPERH* |
Ga0105245_132563341 | 3300009098 | Miscanthus Rhizosphere | SDGKVIEASKVRKDSKVRVHYIKDGDNMLVDKVIVTDVRD* |
Ga0105243_118099772 | 3300009148 | Miscanthus Rhizosphere | GKVIEASKVKKNAKVRVHYMKEGSDMMVDKVIVTDNY* |
Ga0105241_120127321 | 3300009174 | Corn Rhizosphere | VTPSGKVIEASKVKKNSKVKVHYIKEGDDMVVDKVIVTEVRE* |
Ga0126373_101162692 | 3300010048 | Tropical Forest Soil | VTYVTSDGRVIQPSKIRKDSKVQVHYVKDGDDMLIDKVIVTKNRY* |
Ga0134082_104739272 | 3300010303 | Grasslands Soil | RVIEPSKIRKDSKVRVHYLKSGDDVLVDKVIVTDRD* |
Ga0126372_105499402 | 3300010360 | Tropical Forest Soil | VIQPSKIRKDSKVQVHYVKDGDDMLIDKVIVTKNRY* |
Ga0134125_103832371 | 3300010371 | Terrestrial Soil | GRVIEPSQIRKDSKVRVHYLKSGDDMLVDKVIVTDRD* |
Ga0134124_125266491 | 3300010397 | Terrestrial Soil | IEASKIRKDSKVHLHYIKNGDEMLVDKVIVTDVRD* |
Ga0134127_117716661 | 3300010399 | Terrestrial Soil | FSKQVTYVTSDGRVIEASKIRKDSKVQVHYVKDGDNMLVDKVIVTKKRY* |
Ga0105246_120862851 | 3300011119 | Miscanthus Rhizosphere | FSKTVTYITADGRVIDPSKVTKDSKVRVHYLKSGDDMLVDKVVVTERD* |
Ga0120152_10170571 | 3300012011 | Permafrost | AERLAAGKTVTYVTSDGKVIEASKVRKDSKVRVHYLKDGDDMVVDKVIVTRDRD* |
Ga0137362_101654371 | 3300012205 | Vadose Zone Soil | TADGRVIEPSKIRKDSKVRVHYLKSGDDMLVDKVIVTDRD* |
Ga0150985_1121636043 | 3300012212 | Avena Fatua Rhizosphere | GKVIDSSRVRKDARVRVHYTKEGDDMLVDKVIVTDND* |
Ga0137360_100448671 | 3300012361 | Vadose Zone Soil | GKVIEASKIRKDSKVHVHYVRHGDDMVVDKVTLTPERH* |
Ga0137360_112855032 | 3300012361 | Vadose Zone Soil | MTSDGKVIEASKIRKNSKVRVHYVKQGDDMLVDKVIVT |
Ga0137361_115559222 | 3300012362 | Vadose Zone Soil | YTFSKNVEYVNAHGKVIEASKIRKDSKVRVHFVKQGNDLVVDKVILTPDKH* |
Ga0137361_117183032 | 3300012362 | Vadose Zone Soil | IEASKIRKDSKVHVHYVRHGDDMVVDKVTLTPDRH* |
Ga0150984_1182835193 | 3300012469 | Avena Fatua Rhizosphere | PDGKVIDSSRVRKDARVRVHYTKEGDDMLVDRVIVTDND* |
Ga0137397_103996212 | 3300012685 | Vadose Zone Soil | LSVEYVNADGKVIEPSKIRKDSKVRVHYLKQGDNMVVDKVILTPERH* |
Ga0157285_100161442 | 3300012897 | Soil | VIEASKIRKDSKIRVHYIKQGDDMLVDKVIVSDRD* |
Ga0157308_102496961 | 3300012910 | Soil | DGRVIQPSKIRKDSKVHVHYVKQGDDMLVDKVIVTQDRD* |
Ga0137395_107742081 | 3300012917 | Vadose Zone Soil | KVIEASKIRKDSKVHVHYVRHGDDMVVDKVTLTPDRH* |
Ga0137396_108187952 | 3300012918 | Vadose Zone Soil | GKTVTYVTSDGKVVEASKIRKDSKVRVHYIKQGDDMLVDKVIVTDRD* |
Ga0137359_117102861 | 3300012923 | Vadose Zone Soil | VIEASKIRKDSKVRVHFVKQGNDLVVDKVILTPDKH* |
Ga0164303_109134211 | 3300012957 | Soil | QVTYVTSDGRVIEPSKIRKDSKVQVHYIKEGDDMLVDKVIVTKARY* |
Ga0164299_104774461 | 3300012958 | Soil | VTYVNSNGRVIDASKIRKDSKVQVHYVKDGDDMLIDKVIVTKDRD* |
Ga0164299_112828571 | 3300012958 | Soil | DGRVIQPSKIRKDSKVQVHYVKEGNDMLVDKVIVTKDRD* |
Ga0164302_102684193 | 3300012961 | Soil | SDGRVIQPSKIRKDSKVQVHYVKEGNDMLVDKVIVTKDRD* |
Ga0164302_105676923 | 3300012961 | Soil | RVIDASKIRKDSKVQVHYVKDGDDMLIDKVIVTKDRD* |
Ga0164302_107470731 | 3300012961 | Soil | RVIDASKIRKDSKVQVHYVKDGDDMLVDKVIVTKDRD* |
Ga0164305_117404151 | 3300012989 | Soil | VIEASKIHKDSKVKVHYVREGSDMLVDRVIVDDVD* |
Ga0157307_11362981 | 3300013096 | Soil | VASDGRVIEASKIRKDSKIRVHYIKQGDDMLVDRVIVSDRD* |
Ga0157378_131948401 | 3300013297 | Miscanthus Rhizosphere | GKVIEASKVKKNSKVRVHYINEGGSQVVDKVIVLDND* |
Ga0157372_121794912 | 3300013307 | Corn Rhizosphere | VHYRFSKQVTYVTADGRVIDASKIRKDSKVQVHYVRDGDDMLIDKVIVTKDRD* |
Ga0120149_10148541 | 3300014058 | Permafrost | SVNGHGKVIEASKIKKNSKVRVHYLKDGDDMVVDKVIVTRDRD* |
Ga0163163_126277351 | 3300014325 | Switchgrass Rhizosphere | TSYKFSKTVTYITADGRVIDTSKVTKDSKVRVHYLKSGDDMLVDKVVVTERD* |
Ga0157377_108670621 | 3300014745 | Miscanthus Rhizosphere | YKFSKQVTYVIANGRVIDASKIRKDSKVQVHYVKDGDDMLVDKVIVTKDRD* |
Ga0157379_125169561 | 3300014968 | Switchgrass Rhizosphere | GKVIESSTIRKDSKVRVHYVKEGDDMLVDKVIVTETRK* |
Ga0157376_104180143 | 3300014969 | Miscanthus Rhizosphere | IEASKIRKDSKVRVHYIKDGDNMLVDKVIVTDVRD* |
Ga0137403_108410421 | 3300015264 | Vadose Zone Soil | YVTPDGKVVEASKIKKNSKVRVHYTKEGNDMLVDKVIVTDND* |
Ga0132258_104326848 | 3300015371 | Arabidopsis Rhizosphere | PDGRVIQPSTIRKDSKVHVHYVKVGDDMVVDKVIVTKNNE* |
Ga0132258_126951661 | 3300015371 | Arabidopsis Rhizosphere | DGRVIEPSKIRKDSKVQVHYIKEGDDMLVDKVIVTKNRY* |
Ga0132256_1003622713 | 3300015372 | Arabidopsis Rhizosphere | RVIDASKIRKDSKVQVHYVKDGDDMMIDKVIVTKDRD* |
Ga0132256_1009732421 | 3300015372 | Arabidopsis Rhizosphere | FSKQVTYLTADGRVIDASKIRKDSKVQVHYVKDGDDMLIDKVIVTKDRD* |
Ga0132255_1036143491 | 3300015374 | Arabidopsis Rhizosphere | QVTNVTSDGRVIQPSNIRKDSKFQVQYVKEGNDMLVDKVIVTKDRD* |
Ga0132255_1047977712 | 3300015374 | Arabidopsis Rhizosphere | KQVTYVTSDGRVIQPSEIRKDSKVQVHYVKDGDNMLVDKVIVTKTRY* |
Ga0182033_113663602 | 3300016319 | Soil | YVTSDGRVIEPSKIRKDSKVQVHYIKDGDDMLVDKVIVTKARY |
Ga0184604_101063971 | 3300018000 | Groundwater Sediment | KFSKTVTYQTADGRVIEASKIKKDSKVRVHYVKDGDDLLVDKVIVTKDRD |
Ga0184608_103849321 | 3300018028 | Groundwater Sediment | VTSDGQVIEASKIRKDSKVRVHYIKDGDDMVVDKVIVTRNRD |
Ga0066667_111087501 | 3300018433 | Grasslands Soil | PVSDPSKVRTDSKVRVHYIKSRDDMLVDKVIVTDRD |
Ga0173482_101259272 | 3300019361 | Soil | DGRAIEPSQIRKDSKVRVHYLKSGNDMLVDKVIVTD |
Ga0193707_11091961 | 3300019881 | Soil | FSKTVTYQTADGRVIEPSQIRKDSKVRVHYVKSGNDMLVDKVIVTDRD |
Ga0193727_11636261 | 3300019886 | Soil | TADGRVIEPSQIRKDSKVRVHYLKSGDDMLVDKVIVTDRD |
Ga0193729_10164463 | 3300019887 | Soil | VTSAGKVIEASKIRKDSKVRVHYAKEGDDMLVDKVIVTQDRD |
Ga0193729_10271901 | 3300019887 | Soil | VTYVNAHGKVIEASKIRKDSKVHVHYVRQGDDMVVDKVTLAPDRH |
Ga0193729_11368533 | 3300019887 | Soil | KVLEPSKIRKDSKVRVHYIKEGDDMLVDKVIVTDRD |
Ga0193728_10683493 | 3300019890 | Soil | GKVIQPSKIKKDSKVRVHFLKQGDNMVVDKVILTPERH |
Ga0193731_10072223 | 3300020001 | Soil | LKTEATEPMHYTFSKTVEYVNAHGKVIETSKIKKDSKVRVHFLKQGDNMVVDKVILTPNR |
Ga0193735_11672602 | 3300020006 | Soil | FSKEVTYVTAKGRVIDASKIKKDSKVQVHYIKDGDDMLVDKVIVTKHRD |
Ga0193732_10692182 | 3300020012 | Soil | RYVASDGQVVEASKIRKDSKVRVHYIKDGDDMVVDKVIVETGNRY |
Ga0193721_10572641 | 3300020018 | Soil | VTYVTSDGRVIQPSQIRKDSKVHVHYVKDGDDMLVDKVIVTKNRD |
Ga0193745_10895252 | 3300020059 | Soil | FSKQVTYVTSDGRVIQPSKIRKDSKVQVHYVKEGNDMLVDKVIVTKDRD |
Ga0210405_1000218516 | 3300021171 | Soil | FGKTVTCVNAHGKVIEASKIRKDSKVHVHYVRHGDDMVIDKVILTPDRH |
Ga0193719_100626163 | 3300021344 | Soil | PDGKVIEASKVRKNSKVRVHYIKDGSDMLVDKVIVTDND |
Ga0193719_102197001 | 3300021344 | Soil | TYVTSDGQVIEASKIRKDSKVRVHYIKDGDNMVVDKVIVTRDRD |
Ga0193719_103677741 | 3300021344 | Soil | TYVTSDGQVIEASKITKDSKVRVHYIKDGDDMVVDKVIVTRNRY |
Ga0193750_10809301 | 3300021413 | Soil | MRCKFGKTVTYVTSDERVIEASKIRKDSKVRVHYIRNGDDMVVDKVIVTRDRY |
Ga0193695_10171161 | 3300021418 | Soil | DGRVIEPSKIRKDSKVRVHYLKSGDDMLVDKVIVTDRD |
Ga0210384_102982631 | 3300021432 | Soil | KVIEASTIRKDSKVRVHYIKDGDNMLVDKVIVMPDRD |
Ga0210402_105084872 | 3300021478 | Soil | TADGRVIKASKIRKDSKVHVHYIKDNDDMLVDRVTVDQD |
Ga0224452_10632922 | 3300022534 | Groundwater Sediment | VTYVTSDGQVIEASKIRKDSKVRVHYIKDGDNMVVDKVIVTRDRD |
Ga0222623_100614172 | 3300022694 | Groundwater Sediment | TSDGQVIEASKIRKDSKVRVHYIKDGDNMVVDKVIVTRDRD |
Ga0193714_10294791 | 3300023058 | Soil | SDGRVIQPSQIRKDSKVHVHYVKDGDDMLVDKVIVTKDRD |
Ga0247693_10617952 | 3300024181 | Soil | QVKYVTSDGRVIEASKIRKDSKVQVHYVKEGDDMLVDKVIVTKARY |
Ga0207666_10566801 | 3300025271 | Corn, Switchgrass And Miscanthus Rhizosphere | ARYKFSKTVTYQTADGRVIQPSQIRKDSKVRVHYLKSGDDMLVDKVIVTDRD |
Ga0207673_10524991 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | ADGHVVEASRIKKDSKVHVHYVRDNDDMLVDRIVVDQD |
Ga0207692_106728411 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | YVTSDGRVIEPSKIRKDSKVQVHYIKDGDDMLIDKVIVTKARY |
Ga0207684_103624783 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AEPMHYTFSKNVEYVNAHGKVIEASKIRKDSKVHVHFVKQGNDMVVDKVILTPDRH |
Ga0207693_109018471 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSDGRVIEPSKIRKDSKVQVHYIKEGDDMLVDKVIVTKARY |
Ga0207652_111698491 | 3300025921 | Corn Rhizosphere | FSKTVTYQTADGRVIEPSQIRKDSKVRVHYLKSGDDMLVDKVIVTDRD |
Ga0207646_116268041 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GKVIEASKIRKDSKVHVHCVRHGADMVVDKVTLTPERH |
Ga0207659_112084962 | 3300025926 | Miscanthus Rhizosphere | VIEASKIRKDSKVRVHYIKQGDDMLVDKVIVTQDRD |
Ga0207706_116330121 | 3300025933 | Corn Rhizosphere | HGKVIEASKIRKDSKVQVHYLKDGDDMVIDKVIVTPSRD |
Ga0207665_100002795 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDASRIKKNSKVRVHYIKEGNDMLVDKVIVTDTD |
Ga0207651_116990282 | 3300025960 | Switchgrass Rhizosphere | DGRVIEPSQIRKDSKVRVHYLKSGDDMLVDKVIVTDRD |
Ga0207668_109971431 | 3300025972 | Switchgrass Rhizosphere | VTADGHVIEASRIKKDSKVHVHYVRDNDDMLVDRIVVDQD |
Ga0207648_102851712 | 3300026089 | Miscanthus Rhizosphere | KVIEASKIRKDSKVKVHYIKEGDDMVIDKVIVTEVRD |
Ga0209802_10400611 | 3300026328 | Soil | ATEPMHYTFNKNVEYVNAHGKVIEASKIRKDSKVRVHFVKQGNDLVVDKVILTPDKH |
Ga0209377_10366001 | 3300026334 | Soil | NVEFVNAHGKVIEASKIRKDSKVRVHFVKQGNDLVVDKVILTPDKH |
Ga0257146_10677282 | 3300026374 | Soil | PVRYKFSKQVTYVTSDGRVIQPSKIRKDSKVQVHYVKEGNDMLVDKVIVTKDRD |
Ga0257156_11322871 | 3300026498 | Soil | VTYQTADGRVIEPSKIRKDSKVRVHYLKSGDDMLVDKVIVTDRD |
Ga0257158_11084633 | 3300026515 | Soil | FGKSVTYLNANGKVINASKIRKDRKVRVHYVKEGNDMLVDKVTVVKD |
Ga0209805_10682345 | 3300026542 | Soil | GRVIEPSKIRKDSKVRVHYLKSGDDVLVDKVIVTDRD |
Ga0209577_104469292 | 3300026552 | Soil | KVIEASKIRKDSKVHVHYVRHGDDMVVDKVTLTPDRH |
Ga0207558_1015772 | 3300026664 | Soil | TADGRVIDASKIRKDSKVQVHYVKDGDDMLIDKVIVTKDRD |
Ga0207556_1008121 | 3300026684 | Soil | SKTVTYVTADGRVIEPSKIRKDSKVHVHYIKDGDDMLVDKVIVTKDRD |
Ga0208709_1054872 | 3300026693 | Soil | VTSDGRVIEASKIRKDSKVRVHYIKQGDDMLVDKVIVSDRD |
Ga0208475_10006491 | 3300027018 | Soil | VIEASKIRKDSKIRVHYIKQGDDMLVDKVIVSDRD |
Ga0209528_10227681 | 3300027610 | Forest Soil | VTYVTSDGQVIEPSQIRRDSKVRVHYMKEGDDMVVDKVIVTRDRD |
Ga0209328_101989071 | 3300027727 | Forest Soil | RVIEASKIRKDSKVRVHYLKEGNDMVVDKVIVTQDRD |
Ga0307313_102964731 | 3300028715 | Soil | TSDGRVIEASKIRKDSKVRVHYIKQGDDMLVDKVIVTDVRD |
Ga0307311_102339192 | 3300028716 | Soil | SDGQVIEASKIRKDSKVRVHYIKDGDDMVVDKVIVTRNRY |
Ga0307299_101975311 | 3300028793 | Soil | DGRVIEPSQIRKDSKVRVHYLKSGNDMLVDKVIVTD |
Ga0307292_102241311 | 3300028811 | Soil | VTSDGRVIQPSQIRKDSKVHVHYVKNGDDMLVDKVIVTNDRD |
Ga0307310_101797873 | 3300028824 | Soil | QVTYVTSDGRVIQPSQIRKDSNVRVHYVKEGDDMLVDKVIVTKTRD |
Ga0307308_102101472 | 3300028884 | Soil | YVTSDGQVIEASKIRKDSKVRVHYIKDGDDMVVDKVIVTRNRY |
Ga0308197_104194181 | 3300031093 | Soil | VTYVTPDGKVIEASRVKKNAKVRVHYMREGSDMLVDRVIVTDND |
Ga0170824_1176740631 | 3300031231 | Forest Soil | SKQVTYVTSDGRVIQPSKIRKDSKVQVHYVKEGNDMLVDKVIVTKERD |
Ga0170820_104998242 | 3300031446 | Forest Soil | VEPVRYKFSKQVTYVTSDGRVIQPSKIRKDSKVQVHYVKEGNDMLVDKVIVTKDRD |
Ga0170819_165085721 | 3300031469 | Forest Soil | SDGRVIQPSEIRKDSKVQVHYVKDGDNILVDKVIVTKTRY |
Ga0170819_172344672 | 3300031469 | Forest Soil | GKTVTYVTSDGQVIEASKIRKDSKVRVHYIKDGDDMVIDKVIVTRNRY |
Ga0307468_1009117652 | 3300031740 | Hardwood Forest Soil | AYVNAHGKVIEASKIRKDSKVQVHYLKDGDDMVIDKVIVTPSRD |
Ga0307475_107413901 | 3300031754 | Hardwood Forest Soil | KAVTYVTSDGKVIDASKIRKNSKVRVHYVKQGDDMLVDKVIVTQDRD |
Ga0307475_108164712 | 3300031754 | Hardwood Forest Soil | AHGKVIEASKIRKDSKVHVHFVRHGDDMVVDKVTLTPDRH |
Ga0307473_102340582 | 3300031820 | Hardwood Forest Soil | TVTYMTSDGKVIDASKIRKNSKVRVHYVKQGDDMLVDKVIVTQDRD |
Ga0307473_115595652 | 3300031820 | Hardwood Forest Soil | IQPSKIRKDSKVHVHYVKDGDDILVDKVIVTKNRD |
Ga0307478_110837432 | 3300031823 | Hardwood Forest Soil | HGKVIEASKIRKDSKVRVHYVKQGDDMVVDKVILTPDRH |
Ga0310917_111732361 | 3300031833 | Soil | TYVTSDGRVIEPSKIRKDSKVQVHYIKDGDDMLVDKVIVTKNRY |
Ga0310907_107365182 | 3300031847 | Soil | KQVTYVTSDGRVIEPSQIRKDSKVQVHYIKNGDDMLVDKVIVTKNRY |
Ga0307471_1016218593 | 3300032180 | Hardwood Forest Soil | KTVEFVNAHGKVIEASKIRKDSKVHVHYVRHGDDMVVDKVTLTPDRH |
Ga0307471_1039629301 | 3300032180 | Hardwood Forest Soil | SDGKVIEASTIKKDSKVRVHYIKNGDDMLVDKVIVTQDRY |
Ga0307472_1024330481 | 3300032205 | Hardwood Forest Soil | NVTYVTADGKVVEASKIRKDSRVRVHYIKEGNDMLVDKVIVSD |
⦗Top⦘ |